LRRC50 Polyclonal antibody, PBS Only

• 

  IHC staining of mouse testis using 30156-1-AP (same clone as 30156-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30156-1-AP (LRRC50 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30156-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 30156-1-AP (same clone as 30156-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30156-1-AP (LRRC50 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30156-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 30156-1-AP (same clone as 30156-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using LRRC50 antibody (30156-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30156-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 30156-1-AP (same clone as 30156-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using LRRC50 antibody (30156-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30156-1-PBS in a different storage buffer formulation.

LRRC50 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 30156-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

30156-1-PBS targets LRRC50 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32822

  Product name: Recombinant human LRRC50 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 522-680 aa of BC024009

  Sequence: FVTELDGTRTEDLETIRLETKETCCIDDLPDLEDDDETGKSLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFKKEAKRDSEIRKQDTKSPRPLIQELSDEDPSGQPLMPPTCQRDAAPLTSTGDRDS

• Full Name: leucine rich repeat containing 50
• Calculated Molecular Weight: 725 aa, 80 kDa
• GenBank Accession Number: BC024009
• Gene Symbol: LRRC50
• Gene ID (NCBI): 123872
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NEP3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LRRC50 is a cilium-specific protein required for the stability of the ciliary architecture, it plays a role in cytoplasmic preassembly of dynein arms.