Tested Applications
Positive WB detected in | A431 cells |
Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
82094-1-RR targets LY6D in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag10714 Product name: Recombinant human LY6D protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC031330 Sequence: MRTALLLLATLAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPT Predict reactive species |
Full Name | lymphocyte antigen 6 complex, locus D |
Calculated Molecular Weight | 128 aa, 13 kDa |
Observed Molecular Weight | 13-14 kDa |
GenBank Accession Number | BC031330 |
Gene Symbol | LY6D |
Gene ID (NCBI) | 8581 |
RRID | AB_3086462 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q14210 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LY6D, also named as E48 and ThB, may act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. It marks the earliest stage of B-cell specification.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for LY6D antibody 82094-1-RR | Download protocol |
IHC protocol for LY6D antibody 82094-1-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |