Tested Applications
Positive WB detected in | mouse spleen tissue |
Positive IP detected in | K-562 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 2 publications below |
IF | See 1 publications below |
Product Information
24633-1-AP targets LY6G5C in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18812 Product name: Recombinant human LY6G5C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 41-147 aa of BC141637 Sequence: VPVNWEPPQPLPFPKYLRCYRCLLETKELGCLLGSDICLTPAGSSCITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDFCNDPQNRGLYTP Predict reactive species |
Full Name | lymphocyte antigen 6 complex, locus G5C |
Calculated Molecular Weight | 150 aa, 17 kDa |
Observed Molecular Weight | 16 kDa, 32 kDa, 64 kDa |
GenBank Accession Number | BC141637 |
Gene Symbol | LY6G5C |
Gene ID (NCBI) | 80741 |
RRID | AB_2879647 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q5SRR4 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LY6G5C, also known as C6orf20, is a low abundance secreted protein. The function of LY6G5C, remains largely unknown. It may have a role in hematopoietic cell differentiation. Catalog#11714-1-AP can detect the protein and its dimmer and tetramer.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for LY6G5C antibody 24633-1-AP | Download protocol |
IP protocol for LY6G5C antibody 24633-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int J Mol Sci Nicotinamide Mononucleotide Supplementation Alleviates Doxorubicin-Induced Multi-Organ Fibrosis | ||
World J Surg Oncol Prognostic value of circadian rhythm-associated genes in breast cancer |