LY6G5C Polyclonal antibody

• 

  WB analysis of mouse spleen using 24633-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 24633-1-AP (LY6G5C Antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 24633-1-AP

  IP result of anti-LY6G5C (IP:24633-1-AP, 4ug; Detection:24633-1-AP 1:300) with K-562 cells lysate 1720ug.

LY6G5C Polyclonal Antibody for WB, IP, ELISA

Cat No. 24633-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ELISA

Synonyms

C6orf20, G5C, LY6G5CA, LY6G5CB, NG33

---

Tested Applications

• Positive WB detected in: mouse spleen tissue
• Positive IP detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

24633-1-AP targets LY6G5C in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18812

  Product name: Recombinant human LY6G5C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 41-147 aa of BC141637

  Sequence: VPVNWEPPQPLPFPKYLRCYRCLLETKELGCLLGSDICLTPAGSSCITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDFCNDPQNRGLYTP

• Full Name: lymphocyte antigen 6 complex, locus G5C
• Calculated Molecular Weight: 150 aa, 17 kDa
• Observed Molecular Weight: 16 kDa, 32 kDa, 64 kDa
• GenBank Accession Number: BC141637
• Gene Symbol: LY6G5C
• Gene ID (NCBI): 80741
• RRID: AB_2879647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5SRR4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LY6G5C, also known as C6orf20, is a low abundance secreted protein. The function of LY6G5C, remains largely unknown. It may have a role in hematopoietic cell differentiation. Catalog#11714-1-AP can detect the protein and its dimmer and tetramer.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	EBioMedicine; Social stress is lethal in the mdx model of Duchenne muscular dystrophy.; Authors - Maria Razzoli
mouse	IHC	Int J Mol Sci; Nicotinamide Mononucleotide Supplementation Alleviates Doxorubicin-Induced Multi-Organ Fibrosis; Authors - Fei Wen
human	WB,IHC	World J Surg Oncol; Prognostic value of circadian rhythm-associated genes in breast cancer; Authors - Ling Wang