LY6G5C Polyclonal antibody

LY6G5C Polyclonal Antibody for WB, IP, ELISA
Cat No. 24633-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ELISA

C6orf20, G5C, LY6G5CA, LY6G5CB, NG33

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse spleen tissue
Positive IP detected inK-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24633-1-AP targets LY6G5C in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18812

Product name: Recombinant human LY6G5C protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 41-147 aa of BC141637

Sequence: VPVNWEPPQPLPFPKYLRCYRCLLETKELGCLLGSDICLTPAGSSCITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDFCNDPQNRGLYTP

Predict reactive species
Full Name lymphocyte antigen 6 complex, locus G5C
Calculated Molecular Weight 150 aa, 17 kDa
Observed Molecular Weight 16 kDa, 32 kDa, 64 kDa
GenBank Accession NumberBC141637
Gene Symbol LY6G5C
Gene ID (NCBI) 80741
RRIDAB_2879647
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ5SRR4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LY6G5C, also known as C6orf20, is a low abundance secreted protein. The function of LY6G5C, remains largely unknown. It may have a role in hematopoietic cell differentiation. Catalog#11714-1-AP can detect the protein and its dimmer and tetramer.

Protocols

Product Specific Protocols
IP protocol for LY6G5C antibody 24633-1-APDownload protocol
WB protocol for LY6G5C antibody 24633-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

EBioMedicine

Social stress is lethal in the mdx model of Duchenne muscular dystrophy.

Authors - Maria Razzoli
mouseIHC

Int J Mol Sci

Nicotinamide Mononucleotide Supplementation Alleviates Doxorubicin-Induced Multi-Organ Fibrosis

Authors - Fei Wen
humanWB,IHC

World J Surg Oncol

Prognostic value of circadian rhythm-associated genes in breast cancer

Authors - Ling Wang
Loading...
||
New chat Able
正在加载,请稍候...