Tested Applications
| Positive WB detected in | mouse spleen tissue |
| Positive IP detected in | K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24633-1-AP targets LY6G5C in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18812 Product name: Recombinant human LY6G5C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 41-147 aa of BC141637 Sequence: VPVNWEPPQPLPFPKYLRCYRCLLETKELGCLLGSDICLTPAGSSCITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDFCNDPQNRGLYTP Predict reactive species |
| Full Name | lymphocyte antigen 6 complex, locus G5C |
| Calculated Molecular Weight | 150 aa, 17 kDa |
| Observed Molecular Weight | 16 kDa, 32 kDa, 64 kDa |
| GenBank Accession Number | BC141637 |
| Gene Symbol | LY6G5C |
| Gene ID (NCBI) | 80741 |
| RRID | AB_2879647 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5SRR4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LY6G5C, also known as C6orf20, is a low abundance secreted protein. The function of LY6G5C, remains largely unknown. It may have a role in hematopoietic cell differentiation. Catalog#11714-1-AP can detect the protein and its dimmer and tetramer.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for LY6G5C antibody 24633-1-AP | Download protocol |
| WB protocol for LY6G5C antibody 24633-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The LY6G5C2 Polyclonal antibody (Cat# 24633-1-AP) has 7 total citations. These appear in journals including Journal of Controlled Release, EBioMedicine, Environmental International, Frontiers in Immunology, International Journal of Molecular Sciences, Clinical and Experimental Immunology, and World Journal of Surgical Oncology. Research fields span cancer immunotherapy, muscular dystrophy, ulcerative colitis, acute kidney injury, fibrosis, psoriasis, and breast cancer, with applications in IF, IHC, and WB.
| Species | Application | Title |
|---|---|---|
J Control Release Dendritic cell-derived biomimetic vesicles as cancer vaccine platforms for melanoma immunotherapy. | ||
Environ Int Excessive ultra-processed foods exposure aggravates ulcerative colitis via macrophage ferroptosis | ||
Int J Mol Sci Nicotinamide Mononucleotide Supplementation Alleviates Doxorubicin-Induced Multi-Organ Fibrosis | ||
Clin Exp Immunol Hydrogen ameliorates psoriasis-like skin inflammation via inhibiting the cGAS-STING pathway. |
