Tested Applications
Positive WB detected in | Raji cells |
Positive IHC detected in | human testis tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
23933-1-AP targets LY6H in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20762 Product name: Recombinant human LY6H protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 20-140 aa of BC028894 Sequence: SAPAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP Predict reactive species |
Full Name | lymphocyte antigen 6 complex, locus H |
Calculated Molecular Weight | 15 kDa |
Observed Molecular Weight | 16 kDa |
GenBank Accession Number | BC028894 |
Gene Symbol | LY6H |
Gene ID (NCBI) | 4062 |
RRID | AB_2879366 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | O94772 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LY6H is highly expressed in particular subdivisions of human brain and also in MOLT-3 and -4 acute lymphoblastic leukemia cells. It has some isoforms with MW 14-16 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for LY6H antibody 23933-1-AP | Download protocol |
IHC protocol for LY6H antibody 23933-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |