LY6H Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LY6H Polyclonal antibody (23933-1-AP)

LY6H Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23933-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Ly 6H, LY6H, Lymphocyte antigen 6H

• 

  WB analysis of Raji using 23933-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 23933-1-AP (LY6H Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 23933-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis slide using 23933-1-AP (LY6H Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 23933-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis slide using 23933-1-AP (LY6H Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 23933-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 23933-1-AP (LY6H antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 23933-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 23933-1-AP (LY6H antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LY6H in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Raji cells
• Positive IHC detected in: human testis tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23933-1-AP targets LY6H in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20762

  Product name: Recombinant human LY6H protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 20-140 aa of BC028894

  Sequence: SAPAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP

• Full Name: lymphocyte antigen 6 complex, locus H
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC028894
• Gene Symbol: LY6H
• Gene ID (NCBI): 4062
• RRID: AB_2879366
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O94772
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LY6H is highly expressed in particular subdivisions of human brain and also in MOLT-3 and -4 acute lymphoblastic leukemia cells. It has some isoforms with MW 14-16 kDa.

Publications

What published studies show

The LY6H Polyclonal antibody (Cat# 23933-1-AP) has 1 total citation. It appears in Molecular Neurobiology (2025), in a study examining aerobic exercise and multisensory environment training for age-related cognitive decline via hippocampal-prefrontal neural circuit modulation. The research field is neuroscience, specifically focusing on neurodegeneration and neural circuit function. The antibody was used for Western Blot in mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Neurobiol; Integrated Aerobic Exercise and Multisensory Environment Training for Age-related Cognitive Decline via Hippocampal-prefrontal Neural Circuit Modulation.; Authors - Huawei Lin