Filter: AllIHCIF/ICC

IHC staining of human liver using 23833-1-AP
Immunohistochemical analysis of paraffin-embedded human liver slide using 23833-1-AP (LYRM7 Antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human liver using 23833-1-AP
Immunohistochemical analysis of paraffin-embedded human liver slide using 23833-1-AP (LYRM7 Antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human hepatocirrhosis using 23833-1-AP
Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 23833-1-AP (LYRM7 Antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human hepatocirrhosis using 23833-1-AP
Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 23833-1-AP (LYRM7 Antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human kidney using 23833-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 23833-1-AP (LYRM7 Antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human kidney using 23833-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 23833-1-AP (LYRM7 Antibody) at dilution of 1:50 (under 40x lens).
IF Staining of HepG2 using 23833-1-AP
Immunofluorescent analysis of HepG2 cells using 23833-1-AP (LYRM7 antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG.

LYRM7 Polyclonal antibody

Name: LYRM7 Polyclonal antibody
Brand: Proteintech
SKU: 23833-1-AP

LYRM7 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 23833-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

C5orf31, LYR motif containing protein 7, LYRM7, Lyrm7 homolog (mouse)

Formulation: PBS and Azide

PBS and Azide

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

Positive IHC detected in	human liver tissue, human hepatocirrhosis tissue, human kidney tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)/ICC	IF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

23833-1-AP targets LYRM7 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag20696 Product name: Recombinant human LYRM7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC047079 Sequence: MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDIELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ Predict reactive species
Full Name	Lyrm7 homolog (mouse)
Calculated Molecular Weight	104 aa, 12 kDa
GenBank Accession Number	BC047079
Gene Symbol	LYRM7
Gene ID (NCBI)	90624
RRID	AB_2879332
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen Affinity purified
UNIPROT ID	Q5U5X0
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Product Specific Protocols
IHC protocol for LYRM7 antibody 23833-1-AP	Download protocol
IF protocol for LYRM7 antibody 23833-1-AP	Download protocol
FC protocol for LYRM7 antibody 23833-1-AP	Download protocol