Tested Applications
Positive IHC detected in | human liver tissue, human hepatocirrhosis tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
23833-1-AP targets LYRM7 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20696 Product name: Recombinant human LYRM7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC047079 Sequence: MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDIELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ Predict reactive species |
Full Name | Lyrm7 homolog (mouse) |
Calculated Molecular Weight | 104 aa, 12 kDa |
GenBank Accession Number | BC047079 |
Gene Symbol | LYRM7 |
Gene ID (NCBI) | 90624 |
RRID | AB_2879332 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | Q5U5X0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for LYRM7 antibody 23833-1-AP | Download protocol |
IF protocol for LYRM7 antibody 23833-1-AP | Download protocol |
FC protocol for LYRM7 antibody 23833-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |