Tested Applications
| Positive WB detected in | HEK-293 cells, HEK-293 |
| Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
66014-1-Ig targets MAD2L1 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17512 Product name: Recombinant human MAD2L1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 16-185 aa of BC000356 Sequence: SAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRS Predict reactive species |
| Full Name | MAD2 mitotic arrest deficient-like 1 (yeast) |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 24 kDa |
| GenBank Accession Number | BC000356 |
| Gene Symbol | MAD2L1 |
| Gene ID (NCBI) | 4085 |
| RRID | AB_11232424 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13257 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MAD2 mitotic arrest deficient-like 1 (yeast) (MAD2L1, synonyms: MAD2, HSMAD2) is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is localized to human chromosome band 5q23.3 by in situ hybridization.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MAD2L1 antibody 66014-1-Ig | Download protocol |
| WB protocol for MAD2L1 antibody 66014-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |















