MAD2L1 Monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 66014-1-Ig (same clone as 66014-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66014-1-Ig (MAD2L1 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66014-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66014-1-Ig (same clone as 66014-1-PBS)

  WB result of MAD2L1 antibody (66014-1-Ig, 1:2000) with si-control and si-MAD2L1 transfected HEK293 cells. This data was developed using the same antibody clone with 66014-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66014-1-Ig (same clone as 66014-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66014-1-Ig (MAD2L1 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66014-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 66014-1-Ig (same clone as 66014-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 66014-1-Ig (MAD2L1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66014-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66014-1-Ig (same clone as 66014-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66014-1-Ig (MAD2L1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66014-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66014-1-Ig (same clone as 66014-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66014-1-Ig (MAD2L1 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66014-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 66014-1-Ig (same clone as 66014-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis slide using 66014-1-Ig (MAD2L1 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 66014-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 66014-1-Ig (same clone as 66014-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis slide using 66014-1-Ig (MAD2L1 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 66014-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MAD2L1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66014-1-PBS

Clone No.2F5F12

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

2F5F12, HSMAD2, MAD2, MAD2 like protein 1, MAD2-like protein 1

---

Product Information

66014-1-PBS targets MAD2L1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17512

  Product name: Recombinant human MAD2L1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 16-185 aa of BC000356

  Sequence: SAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRS

• Full Name: MAD2 mitotic arrest deficient-like 1 (yeast)
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC000356
• Gene Symbol: MAD2L1
• Gene ID (NCBI): 4085
• RRID: AB_11232424
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13257
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MAD2 mitotic arrest deficient-like 1 (yeast) (MAD2L1, synonyms: MAD2, HSMAD2) is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is localized to human chromosome band 5q23.3 by in situ hybridization.