MAN1B1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84588-1-RR (same clone as 84588-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84588-1-RR (MAN1B1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84588-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 84588-1-RR (same clone as 84588-1-PBS)

  WB result of MAN1B1 antibody (84588-1-RR; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-MAN1B1 transfected HepG2 cells. This data was developed using the same antibody clone with 84588-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 84588-1-RR (same clone as 84588-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84588-1-RR (MAN1B1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84588-1-PBS in a different storage buffer formulation.

• 

  FC experiment of U2OS using 84588-1-RR (same clone as 84588-1-PBS)

  1x10^6 U2OS cells were intracellularly stained with 0.2 ug MAN1B1 Recombinant antibody (84588-1-RR, Clone:241817E10) and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005)(red), or 0.2 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84588-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MAN1B1 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 84588-1-PBS

Clone No.241817E10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

241817E10, EC:3.2.1.113, Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase, ER alpha 1,2 mannosidase, ER alpha-1,2-mannosidase

---

Product Information

84588-1-PBS targets MAN1B1 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28302

  Product name: Recombinant human MAN1B1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 350-699 aa of BC002953

  Sequence: LFLRKAEDFGNRLMPAFRTPSKIPYSDVNIGTGVAHPPRWTSDSTVAEVTSIQLEFRELSRLTGDKKFQEAVEKVTQHIHGLSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGKQETQLLEDYVEAIEGVRTHLLRHSEPSKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVYHGLPASHMELAQELMETCYQMNRQMETGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKPEPRDKMESFFLGETLKYLFLLFSDDPNLLSLDAYVFNTEAHPLPIWTPA

• Full Name: mannosidase, alpha, class 1B, member 1
• Calculated Molecular Weight: 80 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC002953
• Gene Symbol: MAN1B1
• Gene ID (NCBI): 11253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9UKM7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MAN1B1, also known as ERMAN1, MANA-ER, belongs to the glycosyl hydrolase 47 family. MAN1B1 is involved in glycoprotein quality control targeting of misfolded glycoproteins for degradation, specifically converting Man9GlcNAc to Man8GlcNAc isomer B. At high enzyme concentrations, it further trims the carbohydrates to Man5-6GlcNAc2 (PMID: 18003979). Mutations in MAN1B1 cause autosomal-recessive intellectual disability. This gene has been associated with Rafiq syndrome (PMID: 21763484).