• Featured Product
  • KD/KO Validated

MAN1B1 Recombinant monoclonal antibody

MAN1B1 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 84588-1-RR
Clone No.241817E10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

241817E10, EC:3.2.1.113, Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase, ER alpha 1,2 mannosidase, ER alpha-1,2-mannosidase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HuH-7 cells, HeLa cells, LNCaP cells, HEK-293 cells, U-87 MG cells
Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84588-1-RR targets MAN1B1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28302

Product name: Recombinant human MAN1B1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 350-699 aa of BC002953

Sequence: LFLRKAEDFGNRLMPAFRTPSKIPYSDVNIGTGVAHPPRWTSDSTVAEVTSIQLEFRELSRLTGDKKFQEAVEKVTQHIHGLSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGKQETQLLEDYVEAIEGVRTHLLRHSEPSKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVYHGLPASHMELAQELMETCYQMNRQMETGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKPEPRDKMESFFLGETLKYLFLLFSDDPNLLSLDAYVFNTEAHPLPIWTPA

Predict reactive species
Full Name mannosidase, alpha, class 1B, member 1
Calculated Molecular Weight 80 kDa
Observed Molecular Weight 80 kDa
GenBank Accession NumberBC002953
Gene Symbol MAN1B1
Gene ID (NCBI) 11253
RRIDAB_3672084
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9UKM7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAN1B1, also known as ERMAN1, MANA-ER, belongs to the glycosyl hydrolase 47 family. MAN1B1 is involved in glycoprotein quality control targeting of misfolded glycoproteins for degradation, specifically converting Man9GlcNAc to Man8GlcNAc isomer B. At high enzyme concentrations, it further trims the carbohydrates to Man5-6GlcNAc2 (PMID: 18003979). Mutations in MAN1B1 cause autosomal-recessive intellectual disability. This gene has been associated with Rafiq syndrome (PMID: 21763484).

Protocols

Product Specific Protocols
FC protocol for MAN1B1 antibody 84588-1-RRDownload protocol
WB protocol for MAN1B1 antibody 84588-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...