Tested Applications
Positive WB detected in | Ramos cells, HepG2 cells, Daudi cells, HEK-293 cells |
Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
60252-1-Ig targets MAPK13 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21240 Product name: Recombinant human MAPK13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 307-365 aa of BC000433 Sequence: FFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL Predict reactive species |
Full Name | mitogen-activated protein kinase 13 |
Calculated Molecular Weight | 38 kDa |
Observed Molecular Weight | 38-42 kDa |
GenBank Accession Number | BC000433 |
Gene Symbol | MAPK13 |
Gene ID (NCBI) | 5603 |
RRID | AB_2881373 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | O15264 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MAPK13(Mitogen-activated protein kinase 13) is also named as PRKM13, SAPK4 and belongs to the protein kinase superfamily. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MAPK13 antibody 60252-1-Ig | Download protocol |
IHC protocol for MAPK13 antibody 60252-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |