Product Information
60252-1-PBS targets MAPK13 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21240 Product name: Recombinant human MAPK13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 307-365 aa of BC000433 Sequence: FFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL Predict reactive species |
Full Name | mitogen-activated protein kinase 13 |
Calculated Molecular Weight | 38 kDa |
Observed Molecular Weight | 38-42 kDa |
GenBank Accession Number | BC000433 |
Gene Symbol | MAPK13 |
Gene ID (NCBI) | 5603 |
RRID | AB_2881373 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O15264 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
MAPK13(Mitogen-activated protein kinase 13) is also named as PRKM13, SAPK4 and belongs to the protein kinase superfamily. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2.