MBOAT7 Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse testis using 83546-3-RR (same clone as 83546-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 83546-3-RR (MBOAT7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83546-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 83546-3-RR (same clone as 83546-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 83546-3-RR (MBOAT7 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83546-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HuH-7 using 83546-3-RR (same clone as 83546-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HuH-7 cells using MBOAT7 antibody (83546-3-RR, Clone: 240505E8 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83546-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HuH-7 using 83546-3-PBS

  Immunofluorescent analysis of (4% PFA) fixed HuH-7 cells using MBOAT7 antibody (83546-3-PBS, Clone: 240505E8 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of A549 using 83546-3-RR (same clone as 83546-3-PBS)

  1x10^6 A549 cells were intracellularly stained with 0.25 ug MBOAT7 Recombinant antibody (83546-3-RR, Clone:240505E8) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83546-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83546-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83546-3-RR against Human MBOAT7 were performed. The affinity constant is 0.573 nM.

MBOAT7 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, FC (Intra), ELISA

Cat No. 83546-3-PBS

Clone No.240505E8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, FC (Intra), ELISA

Synonyms

1-acylglycerophosphatidylinositol O-acyltransferase, 240505E8, BB1, Bladder and breast carcinoma-overexpressed gene 1 protein, EC:2.3.1.-

---

Tested Applications

• Positive IF/ICC detected in: HuH-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

83546-3-PBS targets MBOAT7 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24466

  Product name: Recombinant human MBOAT7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 284-344 aa of BC006309

  Sequence: SSPEKAASLEYDYETIRNIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLR

• Full Name: membrane bound O-acyltransferase domain containing 7
• Calculated Molecular Weight: 472 aa, 53 kDa
• GenBank Accession Number: BC006309
• Gene Symbol: MBOAT7
• Gene ID (NCBI): 79143
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q96N66
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MBOAT7 (membrane-bound O-acyltransferase domain containing 7), also known as LPIAT, LENG4, or BB1, belongs to the MBOAT superfamily. MBOAT7 acylates lyso-phosphatidylinositol (lyso-PI) with arachidonyl-CoA and is involved in phosphatidylinositol acyl-chain remodeling in the Lands cycle (PMID: 30959108; PMID: 35509994). MBOAT7 deficiency in humans leads to developmental disorders of the central nervous system, with intellectual disability, epilepsy, and autism spectrum disorder (PMID: 37316513). The calculated molecular weight of MBOAT7 is 53 kDa. This antibody can recognize the 45 kDa isoform of MBOAT7.