Tested Applications
| Positive IHC detected in | Human Hepatocellular cancer, mouse bladder tissue, human ovary cancer tissue, mouse heart tissue, mouse adrenal gland tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HuH-7 cells |
| Positive FC (Intra) detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83546-3-RR targets MBOAT7 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag24466 Product name: Recombinant human MBOAT7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 284-344 aa of BC006309 Sequence: SSPEKAASLEYDYETIRNIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLR Predict reactive species |
| Full Name | membrane bound O-acyltransferase domain containing 7 |
| Calculated Molecular Weight | 472 aa, 53 kDa |
| GenBank Accession Number | BC006309 |
| Gene Symbol | MBOAT7 |
| Gene ID (NCBI) | 79143 |
| RRID | AB_3671165 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96N66 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MBOAT7 (membrane-bound O-acyltransferase domain containing 7), also known as LPIAT, LENG4, or BB1, belongs to the MBOAT superfamily. MBOAT7 acylates lyso-phosphatidylinositol (lyso-PI) with arachidonyl-CoA and is involved in phosphatidylinositol acyl-chain remodeling in the Lands cycle (PMID: 30959108; PMID: 35509994). MBOAT7 deficiency in humans leads to developmental disorders of the central nervous system, with intellectual disability, epilepsy, and autism spectrum disorder (PMID: 37316513). The calculated molecular weight of MBOAT7 is 53 kDa. This antibody can recognize the 45 kDa isoform of MBOAT7.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MBOAT7 antibody 83546-3-RR | Download protocol |
| IF protocol for MBOAT7 antibody 83546-3-RR | Download protocol |
| IHC protocol for MBOAT7 antibody 83546-3-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
The product received a 5-star rating for immunofluorescence use on liver tissue at a 1:100 dilution. The reviewer reported excellent performance in IFM and confirmed validation in knockout liver samples, indicating strong specificity and reliable results for this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Eui Jung (Verified Customer) (12-05-2024) | Very good in IFM and validated in KO liver
|
