FcZero-rAb® APC Anti-Mouse MCP-1/CCL2 Rabbit Recombinant Antibody

• 

  FC experiment of RAW 264.7 using APC-FcA98028

  1x10^6 untreated or LPS and Brefeldin A treated RAW 264.7 cells were surface stained with 0.1 ug APC Anti-Mouse MCP-1/CCL2 Rabbit RecAb (APC-FcA98028, Clone: 230483A9). Cells were fixed with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

MCP-1/CCL2 FcZero-rAb^® Recombinant Antibody for FC

Cat No. APC-FcA98028

Clone No.230483A9

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

Ccl2, MCP1, MCP-1, C-C motif chemokine 2, CCL 2

---

Tested Applications

• Positive FC detected in: LPS and Brefeldin A treated RAW 264.7 cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98028 targets MCP-1/CCL2 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0427

  Product name: Recombinant Mouse MCP-1/CCL2 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-148 aa of NM-011333

  Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN

• Full Name: chemokine (C-C motif) ligand 2
• GenBank Accession Number: NM-011333
• Gene Symbol: MCP-1/CCL2
• Gene ID (NCBI): 20296
• Conjugate: APC Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10148
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Monocyte chemotactic protein 1 (MCP-1), also known as CCL2, is chemotactic for monocyte/macrophage, B cell, and T cell, and belongs to the CC subfamily of chemokines. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis.