Product Information
86274-1-PBS targets MCU/CCDC109A in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag24733 Product name: Recombinant human CCDC109A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 155-233 aa of BC034235 Sequence: DLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTT Predict reactive species |
| Full Name | coiled-coil domain containing 109A |
| Calculated Molecular Weight | 35 kDa |
| Observed Molecular Weight | 30-35 kDa |
| GenBank Accession Number | BC034235 |
| Gene Symbol | CCDC109A |
| Gene ID (NCBI) | 90550 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8NE86 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
MCU, also known as CCDC109A, is highly conserved across all eukaryotes. The MCU protein is composed of two coiled-coil domains, two TMDs, and a short motif of amino acids between the two TMDs. Knockdown of MCU dramatically reduces mitochondrial Ca2+ uptake in isolated mitochondria, in permeabilized cells and living cells. MCU has 3 isoforms with MW 40,37 and 35 kDa (refer to UniProt). The observed MW of MCU is mainly between 30 to 35 kDa in paper (PMID: 26341627; 28337252).





