MCU/CCDC109A Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MCU/CCDC109A Recombinant monoclonal antibody (86274-1-RR)

• 

  WB analysis using 86274-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86274-1-RR (CCDC109A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 86274-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MCU/CCDC109A antibody (86274-1-RR, Clone: 250879C3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 86274-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86274-1-RR against Human MCU/CCDC109A were performed. The affinity constant is 1.57 nM.

MCU/CCDC109A Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86274-1-RR

Clone No.250879C3

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

CCDC109A, MCU, C10orf42, Calcium uniporter protein, Calcium uniporter protein, mitochondrial

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, PANC-1 cells, A549 cells, NIH/3T3 cells, mouse skeletal muscle tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

86274-1-RR targets MCU/CCDC109A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24733

  Product name: Recombinant human CCDC109A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 155-233 aa of BC034235

  Sequence: DLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTT

• Full Name: coiled-coil domain containing 109A
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC034235
• Gene Symbol: CCDC109A
• Gene ID (NCBI): 90550
• RRID: AB_3744772
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8NE86
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MCU, also known as CCDC109A, is highly conserved across all eukaryotes. The MCU protein is composed of two coiled-coil domains, two TMDs, and a short motif of amino acids between the two TMDs. Knockdown of MCU dramatically reduces mitochondrial Ca2+ uptake in isolated mitochondria, in permeabilized cells and living cells. MCU has 3 isoforms with MW 40,37 and 35 kDa (refer to UniProt). The observed MW of MCU is mainly between 30 to 35 kDa in paper (PMID: 26341627; 28337252).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Biol Rep; DDRGK1 regulates muscle development by maintaining mitochondrial calcium homeostasis and oxidative phosphorylation via stabilizing IP3R.; Authors - Ping Li ; KO Validated