MED31 Polyclonal antibody

• 

  WB analysis of mouse testis using 16590-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 16590-1-AP (MED31 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 16590-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 16590-1-AP (MED31 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 16590-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MED31 antibody (16590-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

MED31 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 16590-1-AP

Publications(1)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

SOH1, Mediator of RNA polymerase II transcription subunit 31, hSOH1, CGI-125

---

Tested Applications

• Positive WB detected in: mouse testis tissue, human brain tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

16590-1-AP targets MED31 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9008

  Product name: Recombinant human MED31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-131 aa of BC012539

  Sequence: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK

• Full Name: mediator complex subunit 31
• Calculated Molecular Weight: 131 aa, 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC012539
• Gene Symbol: MED31
• Gene ID (NCBI): 51003
• RRID: AB_2142447
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3C7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MED31, also named as SOH1 or CGI-125, is a 131 amino acid protein, which belongs to the Mediator complex subunit 31 family. MED31 localizes in the nucleus. MED31 as a component of the Mediator complex, a coactivator is involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. MED31 functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Dev Biol; The Mediator complex protein Med31 is required for embryonic growth and cell proliferation during mammalian development.; Authors - Risley Michael D MD

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Anh (Verified Customer) (07-15-2021)

very clear bands

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: mouse cardiomyocytes

FH

siting (Verified Customer) (02-17-2021)

good band

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mouse heart

MED31 Antibody Western Blot validation (1:1000 dilution) in mouse heart (Cat no:16590-1-AP)