METTL3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• METTL3 Polyclonal antibody (15073-1-AP)

• Featured Product
• KD/KO Validated

METTL3 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 15073-1-AP Copied!

Publications (687)

Reviews (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey and More (5)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, RIP, IP-MS, ELISA, CUT&Tag

Synonyms

EC:2.1.1.348, hMETTL3, Methyltransferase-like protein 3, MT A70, MTA70

• 

  WB analysis using 15073-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15073-1-AP (METTL3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15073-1-AP

  WB result of METTL3 antibody (15073-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-METTL3 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15073-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15073-1-AP (METTL3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15073-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15073-1-AP (METTL3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15073-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15073-1-AP (METTL3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 15073-1-AP

  IP result of anti-METTL3 (IP:15073-1-AP, 4ug; Detection:15073-1-AP 1:4000) with HEK-293 cells lysate 1800 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 15073-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 15073-1-AP (METTL3 antibody) at dilution of 1:1500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 15073-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 15073-1-AP (METTL3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 15073-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 15073-1-AP (METTL3 antibody) at dilution of 1:1500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 15073-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 15073-1-AP (METTL3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse testis using 15073-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using METTL3 antibody (15073-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse testis using 15073-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using METTL3 antibody (15073-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 15073-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using METTL3 antibody (15073-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for METTL3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HT-1080 cells, mouse testis tissue, HepG2 cells, Jurkat cells, Neuro-2a cells, A549 cells, NCCIT cells, COS-7 cells, rat testis tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human renal cell carcinoma tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:750-1:3000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15073-1-AP targets METTL3 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, RIP, IP-MS, ELISA, CUT&Tag applications and shows reactivity with human, mouse, rat, monkey samples.

• Tested Reactivity: human, mouse, rat, monkey
• Cited Reactivity: human, mouse, rat, pig, monkey, chicken, zebrafish, hamster, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7110

  Product name: Recombinant human METTL3 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 229-580 aa of BC001650

  Sequence: LNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL

• Full Name: methyltransferase like 3
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC001650
• Gene Symbol: METTL3
• Gene ID (NCBI): 56339
• RRID: AB_2142033
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86U44
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

METTL3 is a key S-adenosyl-L-methionine-binding subunit, which is a component of a complex multicomponent enzyme that catalyzes the methylation of internal adenosine residues in eukaryotic mRNA, forming N6-methyladenosine. It contains 2 putative nuclear localization signals and 2 consensus methylation motifs. The calculated molecular weight of METTL3 is 64 kDa, but modified METTL3 is about 65-70 kDa.

Publications

What published studies show

The METTL3 Polyclonal antibody (Cat# 15073-1-AP) has accumulated 687 citations. Publications span high-impact journals including Nature, Science, Cell, Cancer Cell, Nature Medicine, Nature Communications, Nature Cell Biology, Cell Research, Molecular Cell, Nature Methods, and Gastroenterology, among many others. Research fields covered include m6A RNA methylation/epitranscriptomics, cancer biology, stem cell biology, neurodegeneration, immunology, metabolism, cardiovascular disease, aging, viral infections, and ferroptosis.

Automatically generated from the 687 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Signal Transduct Target Ther; Characterization of ACTN4 as a novel antiviral target against SARS-CoV-2; Authors - Miao Zhu
mouse	WB	Nature; The RNA m6A reader YTHDC1 silences retrotransposons and guards ES cell identity.; Authors - Jiadong Liu ; KO Validated
human	WB	Nature; mRNA circularization by METTL3-eIF3h enhances translation and promotes oncogenesis.; Authors - Junho Choe ; KD Validated
mouse	WB	Nature; METTL3 regulates heterochromatin in mouse embryonic stem cells.; Authors - Wenqi Xu ; KO Validated
human	WB	Nature; N(6)-methyladenosine-dependent regulation of messenger RNA stability.; Authors - Wang Xiao X ; KD Validated
mouse	WB	Cancer Cell; N6-Methyladenosine on mRNA facilitates a phase-separated nuclear body that suppresses myeloid leukemic differentiation.; Authors - Yuanming Cheng ; KO Validated

Reviews

4.9 out of 5

11 verified customer reviews

What customers say

Customers rate this antibody highly (mostly 5 stars) for Western Blot, with several also confirming good performance in Immunofluorescence and Immunohistochemistry. Reviewers report clear, specific bands at the expected size and strong signal across a range of samples, including HEK293T, HeLa, HCT-116, AC16, and brain tissues/cell lines. Recommended dilutions span 1:400 to 1:3000 for WB and 1:200 for IHC/IF, typically with overnight incubation. One reviewer noted a clear band at the expected size but some nonspecific lower-molecular-weight bands at 1:1000. Overall, users describe it as reliable, specific, and highly recommended.

Automatically generated from the 11 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Mounika (Verified Customer) (12-25-2025)

Antibody is working good, bands are good

• Applications: Western Blot, Immunofluorescence
• Primary Antibody Dilution: 1:400

Vikas (Verified Customer) (12-23-2024)

Used for IB works very well.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HEK-293T

Tatyana (Verified Customer) (12-22-2024)

Worked well in WB (in 4% milk in TBST, ON incubation).

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HeLa and SH-SY5Y cells/human

METTL3 Antibody Western Blot validation (1:1000 dilution) in HeLa and SH-SY5Y cells/human (Cat no:15073-1-AP)

RASHMI (Verified Customer) (11-27-2024)

Good

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HEK-293

RASHMI (Verified Customer) (07-26-2024)

Used this product, highly recommended

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HEK-293

RASHMI (Verified Customer) (07-26-2024)

Used this product, highly recommended

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HEK-293

Fanpeng (Verified Customer) (03-14-2024)

This antibody works well in my WB and IHC/IF analysis using multiple cell lines and brain tissues.

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Primary Antibody Dilution: 1:2000 WB, 1:200 IHC/IF
• Cell Tissue Type: human brain/mouse brain/rat brain/N2a/M17/BV2/primary mouse brain cells

PK (Verified Customer) (03-20-2023)

Good

• Applications: Western Blot
• Primary Antibody Dilution: 1000
• Cell Tissue Type: AC16

METTL3 Antibody Western Blot validation (1000 dilution) in AC16 (Cat no:15073-1-AP)

Biao (Verified Customer) (12-23-2019)

This antibody is quite specific and gives strong signal.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: HCT-116

Shuliang (Verified Customer) (10-14-2019)

Good products

• Applications: Western Blot,
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: HEK293T cells

METTL3 Antibody Western Blot, validation (1:3000 dilution) in HEK293T cells (Cat no:15073-1-AP)

Mattia (Verified Customer) (08-26-2019)

Clear band at expected size. Multiple unspecific bands at lower Kda. 1:1000 primary antibody dilution, blocked in 5% milk. Primary incubated overnight.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HeLa, HEK293T