METTL3 Polyclonal antibody

• 

  WB analysis of HeLa using 15073-1-AP

  WB result of METTL3 antibody (15073-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-METTL3 transfected HeLa cells.

• 

  WB analysis using 15073-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15073-1-AP (METTL3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15073-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15073-1-AP (METTL3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15073-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15073-1-AP (METTL3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15073-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15073-1-AP (METTL3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 15073-1-AP

  IP result of anti-METTL3 (IP:15073-1-AP, 4ug; Detection:15073-1-AP 1:4000) with HEK-293 cells lysate 1800 ug.

• 

  IHC staining of human renal cell carcinoma using 15073-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 15073-1-AP (METTL3 antibody) at dilution of 1:1500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 15073-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 15073-1-AP (METTL3 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human renal cell carcinoma using 15073-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 15073-1-AP (METTL3 antibody) at dilution of 1:1500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 15073-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 15073-1-AP (METTL3 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 15073-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using METTL3 antibody (15073-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 15073-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using METTL3 antibody (15073-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 15073-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using METTL3 antibody (15073-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

METTL3 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 15073-1-AP

Publications(523)

Reviews (10)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey and More (6)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, RIP, ELISA

Synonyms

EC:2.1.1.348, hMETTL3, Methyltransferase-like protein 3, MT A70, MTA70

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HT-1080 cells, mouse testis tissue, HepG2 cells, Jurkat cells, Neuro-2a cells, A549 cells, NCCIT cells, COS-7 cells, rat testis tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human renal cell carcinoma tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:750-1:3000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 184 publications below
• WB: See 469 publications below
• IHC: See 80 publications below
• IF: See 59 publications below
• IP: See 18 publications below
• CoIP: See 13 publications below
• ChIP: See 4 publications below
• RIP: See 29 publications below

Product Information

15073-1-AP targets METTL3 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

• Tested Reactivity: human, mouse, rat, monkey
• Cited Reactivity: human, mouse, rat, pig, monkey, chicken, zebrafish, hamster, goat, drosophila
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7110

  Product name: Recombinant human METTL3 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 229-580 aa of BC001650

  Sequence: LNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL

• Full Name: methyltransferase like 3
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC001650
• Gene Symbol: METTL3
• Gene ID (NCBI): 56339
• RRID: AB_2142033
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86U44
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

METTL3 is a key S-adenosyl-L-methionine-binding subunit, which is a component of a complex multicomponent enzyme that catalyzes the methylation of internal adenosine residues in eukaryotic mRNA, forming N6-methyladenosine. It contains 2 putative nuclear localization signals and 2 consensus methylation motifs. The calculated molecular weight of METTL3 is 64 kDa, but modified METTL3 is about 65-70 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; The RNA m6A reader YTHDC1 silences retrotransposons and guards ES cell identity.; Authors - Jiadong Liu ; KO Validated
mouse	WB	Nature; METTL3 regulates heterochromatin in mouse embryonic stem cells.; Authors - Wenqi Xu ; KO Validated
human	WB	Nature; mRNA circularization by METTL3-eIF3h enhances translation and promotes oncogenesis.; Authors - Junho Choe ; KD Validated
human	WB	Nature; N(6)-methyladenosine-dependent regulation of messenger RNA stability.; Authors - Wang Xiao X ; KD Validated
human	WB	Mol Cancer; A positive feedback circuit driven by m6A-modified circular RNA facilitates colorectal cancer liver metastasis; Authors - Kaixuan Zeng ; KD Validated
mouse	WB,IF	Science; Stem cells. m6A mRNA methylation facilitates resolution of naïve pluripotency toward differentiation.; Authors - Shay Geula ; KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Vikas (Verified Customer) (12-23-2024)

Used for IB works very well.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HEK-293T

FH

Tatyana (Verified Customer) (12-22-2024)

Worked well in WB (in 4% milk in TBST, ON incubation).

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HeLa and SH-SY5Y cells/human

METTL3 Antibody Western Blot validation (1:1000 dilution) in HeLa and SH-SY5Y cells/human (Cat no:15073-1-AP)

FH

RASHMI (Verified Customer) (11-27-2024)

Good

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HEK-293

FH

RASHMI (Verified Customer) (07-26-2024)

Used this product, highly recommended

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HEK-293

FH

RASHMI (Verified Customer) (07-26-2024)

Used this product, highly recommended

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HEK-293

FH

Fanpeng (Verified Customer) (03-14-2024)

This antibody works well in my WB and IHC/IF analysis using multiple cell lines and brain tissues.

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Primary Antibody Dilution: 1:2000 WB, 1:200 IHC/IF
• Cell Tissue Type: human brain/mouse brain/rat brain/N2a/M17/BV2/primary mouse brain cells

FH

PK (Verified Customer) (03-20-2023)

Good

• Applications: Western Blot
• Primary Antibody Dilution: 1000
• Cell Tissue Type: AC16

METTL3 Antibody Western Blot validation (1000 dilution) in AC16 (Cat no:15073-1-AP)

FH

Biao (Verified Customer) (12-23-2019)

This antibody is quite specific and gives strong signal.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: HCT-116

FH

Shuliang (Verified Customer) (10-14-2019)

Good products

• Applications: Western Blot,
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: HEK293T cells

METTL3 Antibody Western Blot, validation (1:3000 dilution) in HEK293T cells (Cat no:15073-1-AP)

FH

Mattia (Verified Customer) (08-26-2019)

Clear band at expected size. Multiple unspecific bands at lower Kda. 1:1000 primary antibody dilution, blocked in 5% milk. Primary incubated overnight.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HeLa, HEK293T