Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HT-1080 cells, mouse testis tissue, HepG2 cells, Jurkat cells, Neuro-2a cells, A549 cells, NCCIT cells, COS-7 cells, rat testis tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human renal cell carcinoma tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse testis tissue |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:750-1:3000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15073-1-AP targets METTL3 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.
| Tested Reactivity | human, mouse, rat, monkey |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, zebrafish, hamster, goat, drosophila |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7110 Product name: Recombinant human METTL3 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 229-580 aa of BC001650 Sequence: LNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL Predict reactive species |
| Full Name | methyltransferase like 3 |
| Calculated Molecular Weight | 64 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC001650 |
| Gene Symbol | METTL3 |
| Gene ID (NCBI) | 56339 |
| RRID | AB_2142033 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86U44 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
METTL3 is a key S-adenosyl-L-methionine-binding subunit, which is a component of a complex multicomponent enzyme that catalyzes the methylation of internal adenosine residues in eukaryotic mRNA, forming N6-methyladenosine. It contains 2 putative nuclear localization signals and 2 consensus methylation motifs. The calculated molecular weight of METTL3 is 64 kDa, but modified METTL3 is about 65-70 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for METTL3 antibody 15073-1-AP | Download protocol |
| IHC protocol for METTL3 antibody 15073-1-AP | Download protocol |
| IP protocol for METTL3 antibody 15073-1-AP | Download protocol |
| WB protocol for METTL3 antibody 15073-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nature The RNA m6A reader YTHDC1 silences retrotransposons and guards ES cell identity.
| ||
Nature mRNA circularization by METTL3-eIF3h enhances translation and promotes oncogenesis.
| ||
Mol Cancer A positive feedback circuit driven by m6A-modified circular RNA facilitates colorectal cancer liver metastasis
| ||
Science Stem cells. m6A mRNA methylation facilitates resolution of naïve pluripotency toward differentiation.
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Mounika (Verified Customer) (12-25-2025) | Antibody is working good, bands are good
|
FH Vikas (Verified Customer) (12-23-2024) | Used for IB works very well.
|
FH Tatyana (Verified Customer) (12-22-2024) | Worked well in WB (in 4% milk in TBST, ON incubation).
![]() |
FH RASHMI (Verified Customer) (11-27-2024) | Good
|
FH RASHMI (Verified Customer) (07-26-2024) | Used this product, highly recommended
|
FH RASHMI (Verified Customer) (07-26-2024) | Used this product, highly recommended
|
FH Fanpeng (Verified Customer) (03-14-2024) | This antibody works well in my WB and IHC/IF analysis using multiple cell lines and brain tissues.
|
FH PK (Verified Customer) (03-20-2023) | Good
![]() |
FH Biao (Verified Customer) (12-23-2019) | This antibody is quite specific and gives strong signal.
|
FH Shuliang (Verified Customer) (10-14-2019) | Good products
![]() |
FH Mattia (Verified Customer) (08-26-2019) | Clear band at expected size. Multiple unspecific bands at lower Kda. 1:1000 primary antibody dilution, blocked in 5% milk. Primary incubated overnight.
|




























