MFF Monoclonal antibody, PBS Only

• 

  WB analysis of pig brain using 66527-1-Ig (same clone as 66527-1-PBS)

  pig/rat/mouse brain tissues were subjected to SDS PAGE followed by western blot with 66527-1-Ig (MFF antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66527-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 66527-1-Ig (same clone as 66527-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 66527-1-Ig (MFF antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66527-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 66527-1-Ig (same clone as 66527-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66527-1-Ig (MFF antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66527-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66527-1-Ig (same clone as 66527-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66527-1-Ig (MFF antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66527-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66527-1-Ig (same clone as 66527-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66527-1-Ig (MFF antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66527-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 66527-1-Ig (same clone as 66527-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using MFF antibody (66527-1-Ig, Clone: 1G4B12 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66527-1-PBS in a different storage buffer formulation.

MFF Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 66527-1-PBS

Clone No.1G4B12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

1G4B12, AD033, C2orf33, GL004, Mitochondrial fission factor

---

Product Information

66527-1-PBS targets MFF in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9990

  Product name: Recombinant human MFF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-238 aa of BC000797

  Sequence: MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR

• Full Name: mitochondrial fission factor
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC000797
• Gene Symbol: MFF
• Gene ID (NCBI): 56947
• RRID: AB_2881890
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9GZY8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mitochondrial Fission Factor (MFF) is a critical regulator of organelle division, specifically playing a central role in the fission of mitochondria and peroxisomes. DRP1, MiD, and MFF form a trimeric complex in which MiD proteins facilitate the MFF-DRP1 interaction. Moreover, MiD51 can inhibit MFF-induced activation of DRP1 GTPase activity. Multiple isoforms of MFF exist due to the alternative splicing. This antibody recognizes the endogenous MFF protein around 26-29 kDa and 35-38 kDa.(PMID: 39365854, PMID: 37291333)