MID2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68359-1-Ig (same clone as 68359-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68359-1-Ig (MID2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68359-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 68359-1-Ig (same clone as 68359-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 68359-1-Ig (MID2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68359-1-PBS in a different storage buffer formulation.

MID2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68359-1-PBS

Clone No.1F9E4

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

FLJ37715, FLJ41813, FXY2, MID2, Midin 2, midline 2, Midline defect 2, RING finger protein 60, RNF60, TRIM1

---

Product Information

68359-1-PBS targets MID2 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30793

  Product name: Recombinant human MID2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 336-685 aa of BC017707

  Sequence: AERVAMATASSQVLIPDINFNDAFENFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTITVHWISDDEFSISSYELQYTIFTGQANFISLYNSVDSWMIVPNIKQNHYTVHGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEKDESSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIGIAYKSAPKNEWIGKNASSWVFSRCNSNFVVRHNNKEMLVDVPPHLKRLGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNKSLMILSGLPAPDFIDYPERQECNCRPQESPYVSGMKTCH

• Full Name: midline 2
• Calculated Molecular Weight: 715 aa, 81 kDa
• Observed Molecular Weight: 80~83 kDa
• GenBank Accession Number: BC017707
• Gene Symbol: MID2
• Gene ID (NCBI): 11043
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UJV3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Midline2 (MID2) is an ubiquitin-conjugating E2 enzyme that is involved in tumor development and has a physical interaction with breast cancer 1,early-onset (BRCA1).