MIER1 Polyclonal antibody, PBS Only

• 

  WB analysis of human testis using 11452-1-AP (same clone as 11452-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 11452-1-AP (MIER1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11452-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 11452-1-AP (same clone as 11452-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11452-1-AP (MIER1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11452-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 11452-1-AP (same clone as 11452-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11452-1-AP (MIER1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11452-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 11452-1-AP (same clone as 11452-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11452-1-AP (MIER1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11452-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 11452-1-AP (same clone as 11452-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11452-1-AP (MIER1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11452-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 11452-1-AP (same clone as 11452-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11452-1-AP (MIER1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11452-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 11452-1-AP (same clone as 11452-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11452-1-AP (MIER1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11452-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 11452-1-AP (same clone as 11452-1-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug MIER1 Polyclonal antibody (11452-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 11452-1-PBS in a different storage buffer formulation.

MIER1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11452-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

MIER 1, MI ER1, hMi-er1, hMIER1, hMI ER1

---

Product Information

11452-1-PBS targets MIER1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2010

  Product name: Recombinant human MIER1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC017423

  Sequence: SADMLVHDFDDERTLEEEEMMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNSEVEEESEEDEDYIPSEDWKKEIMVGSMFQAEIPVGICRY

• Full Name: mesoderm induction early response 1 homolog (Xenopus laevis)
• Calculated Molecular Weight: 536 aa, 61 kDa
• Observed Molecular Weight: 82 kDa
• GenBank Accession Number: BC017423
• Gene Symbol: MIER1
• Gene ID (NCBI): 57708
• RRID: AB_10733247
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N108
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.