MIER1 Polyclonal antibody

• 

  WB analysis of human testis using 11452-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 11452-1-AP (MIER1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 11452-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11452-1-AP (MIER1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 11452-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11452-1-AP (MIER1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 11452-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11452-1-AP (MIER1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 11452-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11452-1-AP (MIER1 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human pancreas cancer using 11452-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11452-1-AP (MIER1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human pancreas cancer using 11452-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 11452-1-AP (MIER1 Antibody) at dilution of 1:50 (under 10x lens).

• 

  FC experiment of A431 using 11452-1-AP

  1x10^6 A431 cells were intracellularly stained with 0.25 ug MIER1 Polyclonal antibody (11452-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

MIER1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11452-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ChIP, ELISA

Synonyms

Er1, hMI ER1, hMIER1, hMi-er1, MI ER1

---

Tested Applications

• Positive WB detected in: human testis tissue, HepG2 cells, mouse heart tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• ChIP: See 1 publications below

Product Information

11452-1-AP targets MIER1 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2010

  Product name: Recombinant human MIER1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC017423

  Sequence: SADMLVHDFDDERTLEEEEMMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNSEVEEESEEDEDYIPSEDWKKEIMVGSMFQAEIPVGICRY

• Full Name: mesoderm induction early response 1 homolog (Xenopus laevis)
• Calculated Molecular Weight: 536 aa, 61 kDa
• Observed Molecular Weight: 82 kDa
• GenBank Accession Number: BC017423
• Gene Symbol: MIER1
• Gene ID (NCBI): 57708
• RRID: AB_10733247
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N108
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,ChIP	Gastroenterology; Proteomic characterization identifies clinically relevant subgroups of gastrointestinal stromal tumors; Authors - Mingjun Sun
mouse	IHC	Nat Commun; Acute liver steatosis translationally controls the epigenetic regulator MIER1 to promote liver regeneration in a study with male mice; Authors - Yanhao Chen
human	WB	Cell Chem Biol; HDAC3 and HDAC8 PROTAC dual degrader reveals roles of histone acetylation in gene regulation; Authors - Yufeng Xiao