Mouse MIF Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83199-2-RR (same clone as 83199-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83199-2-RR (MIF antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83199-2-PBS in a different storage buffer formulation.

• 

  FC experiment of RAW 264.7 using 83199-2-RR (same clone as 83199-2-PBS)

  1x10^6 RAW 264.7 cells were intracellularly stained with 0.25 ug MIF Recombinant antibody (83199-2-RR, Clone:230529F2) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83199-2-PBS in a different storage buffer formulation.

• 

  FC experiment of Neuro-2a using 83199-2-RR (same clone as 83199-2-PBS)

  1x10^6 Neuro-2a cells were intracellularly stained with 0.25 ug MIF Recombinant antibody (83199-2-RR, Clone:230529F2) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83199-2-PBS in a different storage buffer formulation.

• 

  FC experiment of NIH/3T3 using 83199-2-RR (same clone as 83199-2-PBS)

  1x10^6 NIH/3T3 cells were intracellularly stained with 0.2 ug MIF Recombinant antibody (83199-2-RR, Clone:230529F2) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.2 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83199-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83199-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 83199-2-PBS against Mouse MIF was performed. The affinity constant is 0.473 nM.

• 

  Affinity and Kinetic Characterization of 83199-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83199-2-RR against Mouse MIF were performed. The affinity constant is 0.131 nM.

MIF Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 83199-2-PBS

Clone No.230529F2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

230529F2, GIF

---

Product Information

83199-2-PBS targets MIF in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0574

  Product name: Recombinant mouse MIF protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 2-115 aa of NM_010798.2

  Sequence: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

• Full Name: macrophage migration inhibitory factor
• Calculated Molecular Weight: 13KD
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: NM_010798.2
• Gene Symbol: Mif
• Gene ID (NCBI): 17319
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P34884
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Macrophage migration inhibitory factor (MIF) is a homo-trimeric protein that acts as a pleiotropic pro-inflammatory cytokine. It is involved in various functions, including leukocyte recruitment, inflammation, immune responses, cell proliferation, tumorigenesis, and counter-regulation of glucocorticoids (GC). MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates.