MIF Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MIF Recombinant monoclonal antibody (83199-2-RR)

MIF Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 83199-2-RR Copied!

Clone No. 230529F2

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

230529F2, GIF

• 

  WB analysis using 83199-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83199-2-RR (MIF antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of NIH/3T3 using 83199-2-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using MIF antibody (83199-2-RR, Clone: 230529F2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of RAW 264.7 using 83199-2-RR

  1x10^6 RAW 264.7 cells were intracellularly stained with 0.25 ug MIF Recombinant antibody (83199-2-RR, Clone:230529F2) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Neuro-2a using 83199-2-RR

  1x10^6 Neuro-2a cells were intracellularly stained with 0.25 ug MIF Recombinant antibody (83199-2-RR, Clone:230529F2) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of NIH/3T3 using 83199-2-RR

  1x10^6 NIH/3T3 cells were intracellularly stained with 0.2 ug MIF Recombinant antibody (83199-2-RR, Clone:230529F2) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.2 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 83199-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83199-2-RR against Mouse MIF were performed. The affinity constant is 0.131 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MIF in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, Jurkat cells, THP-1 cells, RAW 264.7 cells, Neuro-2a cells, mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: NIH/3T3 cells
• Positive FC (Intra) detected in: Neuro-2a cells, RAW 264.7 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83199-2-RR targets MIF in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0574

  Product name: Recombinant mouse MIF protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 2-115 aa of NM_010798.2

  Sequence: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

• Full Name: macrophage migration inhibitory factor
• Calculated Molecular Weight: 13KD
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: NM_010798.2
• Gene Symbol: Mif
• Gene ID (NCBI): 17319
• RRID: AB_3670887
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P34884
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Macrophage migration inhibitory factor (MIF) is a homo-trimeric protein that acts as a pleiotropic pro-inflammatory cytokine. It is involved in various functions, including leukocyte recruitment, inflammation, immune responses, cell proliferation, tumorigenesis, and counter-regulation of glucocorticoids (GC). MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates.

Publications

What published studies show

The MIF Recombinant monoclonal antibody (230529F2), catalog number 83199-2-RR, has 1 total citation. It appears in Pathology Research and Practice (Impact Factor 3.7), published in January 2026. The cited study investigates how CSB6B attenuates renal inflammation and fibrosis by inhibiting NLRP3 inflammasome activation through the NLRP3/Caspase-1/GSDMD/IL-1β signaling pathway, placing the research in the fields of renal pathology and inflammatory disease. The antibody was used for Western blot in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Pathol Res Pract; CSB6B attenuates renal inflammation and fibrosis by inhibiting the activation of NLRP3 inflammasome through the NLRP3/Caspase-1/GSDMD/IL-1β signaling pathway.; Authors - Shuo Chen