MIF Recombinant monoclonal antibody

MIF Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83199-2-RR
Clone No.230529F2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

230529F2, GIF

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, Jurkat cells, THP-1 cells, RAW 264.7 cells, Neuro-2a cells, mouse brain tissue, rat brain tissue
Positive FC (Intra) detected inNeuro-2a cells, RAW 264.7 cells, NIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83199-2-RR targets MIF in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0574

Product name: Recombinant mouse MIF protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 2-115 aa of NM_010798.2

Sequence: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA

Predict reactive species
Full Name macrophage migration inhibitory factor
Calculated Molecular Weight13KD
Observed Molecular Weight13 kDa
GenBank Accession NumberNM_010798.2
Gene Symbol Mif
Gene ID (NCBI) 17319
RRIDAB_3670887
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP34884
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Macrophage migration inhibitory factor (MIF) is a homo-trimeric protein that acts as a pleiotropic pro-inflammatory cytokine. It is involved in various functions, including leukocyte recruitment, inflammation, immune responses, cell proliferation, tumorigenesis, and counter-regulation of glucocorticoids (GC). MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates.

Protocols

Product Specific Protocols
FC protocol for MIF antibody 83199-2-RRDownload protocol
WB protocol for MIF antibody 83199-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...