Product Information
13397-1-PBS targets CCL19/MIP-3 beta in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4200 Product name: Recombinant human MIP3β protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC027968 Sequence: MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 19 |
| Calculated Molecular Weight | 98 aa, 12 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC027968 |
| Gene Symbol | CCL19/MIP-3 beta |
| Gene ID (NCBI) | 6363 |
| RRID | AB_2071529 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99731 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CCL19, also known as MIP-3β, is one of several CC cytokine genes clustered on the p-arm of chromosome 9. CCL19 may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7.









