Tested Applications
| Positive WB detected in | THP-1 cells |
| Positive IF/ICC detected in | A549 cells |
| Positive FC (Intra) detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 4 publications below |
| IF | See 5 publications below |
Product Information
13397-1-AP targets CCL19/MIP-3 beta in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4200 Product name: Recombinant human MIP3β protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC027968 Sequence: MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 19 |
| Calculated Molecular Weight | 98 aa, 12 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC027968 |
| Gene Symbol | CCL19/MIP-3 beta |
| Gene ID (NCBI) | 6363 |
| RRID | AB_2071529 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99731 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CCL19, also known as MIP-3β, is one of several CC cytokine genes clustered on the p-arm of chromosome 9. CCL19 may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CCL19/MIP-3 beta antibody 13397-1-AP | Download protocol |
| IF protocol for CCL19/MIP-3 beta antibody 13397-1-AP | Download protocol |
| WB protocol for CCL19/MIP-3 beta antibody 13397-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Am J Respir Crit Care Med Pulmonary lymphoid neogenesis in idiopathic pulmonary arterial hypertension. | ||
Ann Rheum Dis Global chemokine expression in systemic sclerosis (SSc): CCL19 expression correlates with vascular inflammation in SSc skin. | ||
Front Immunol The Impact of Immune Microenvironment on the Prognosis of Pancreatic Ductal Adenocarcinoma Based on Multi-Omics Analysis | ||
J Innate Immun The Gene Signature of Activated M-CSF-Primed Human Monocyte-Derived Macrophages Is IL-10-Dependent | ||
Front Physiol Potential biomarkers and immune cell infiltration involved in aortic valve calcification identified through integrated bioinformatics analysis | ||
Biomol Biomed Identifying key inflammatory genes in psoriasis via weighted gene co-expression network analysis: Potential targets for therapy |









