Tested Applications
| Positive WB detected in | HEK-293 cells, rat pancreas tissue, mouse pancreas tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22772-1-AP targets MIXL1 in WB, IF, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, pig, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18732 Product name: Recombinant human MIXL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 147-232 aa of BC113441 Sequence: KSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF Predict reactive species |
| Full Name | Mix1 homeobox-like 1 (Xenopus laevis) |
| Calculated Molecular Weight | 232 aa, 25 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC113441 |
| Gene Symbol | MIXL1 |
| Gene ID (NCBI) | 83881 |
| RRID | AB_2879164 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q9H2W2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Mix1 homeobox-like 1 (MIXL1) Transcription factor that play a central role in proper axial mesendoderm morphogenesis and endoderm formation. Required for efficient differentiation of cells from the primitive streak stage to blood, by acting early in the recruitment and/or expansion of mesodermal progenitors to the hemangioblastic and hematopoietic lineages. Also involved in the morphogenesis of the heart and the gut during embryogenesis. Acts as a negative regulator of brachyury expression. This antibody is specific to MIXL1.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for MIXL1 antibody 22772-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MIXL1 Polyclonal antibody (Cat# 22772-1-AP) has 10 citations. These appear in journals including Cell Stem Cell, Cell Death & Differentiation, Advanced Healthcare Materials, Cell Genomics, Stem Cell Research & Therapy, International Journal of Molecular Sciences, Frontiers in Cell and Developmental Biology, STAR Protocols, and Stem Cell Research. The research fields span stem cell biology, kidney organoid generation, cardiac differentiation, podocyte modeling, mesoderm specification, and induced pluripotent stem cell characterization.
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Generation of Human PSC-Derived Kidney Organoids with Patterned Nephron Segments and a De Novo Vascular Network. | ||
Cell Death Differ Uric acid: a potent molecular contributor to pluripotent stem cell cardiac differentiation via mesoderm specification. | ||
Stem Cell Res Ther Podocytes derived from human induced pluripotent stem cells: characterization, comparison, and modeling of diabetic kidney disease | ||
