Tested Applications
Positive WB detected in | HEK-293 cells, rat pancreas tissue |
Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IF | See 6 publications below |
Product Information
22772-1-AP targets MIXL1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Cited Reactivity | human, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18732 Product name: Recombinant human MIXL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 147-232 aa of BC113441 Sequence: KSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF Predict reactive species |
Full Name | Mix1 homeobox-like 1 (Xenopus laevis) |
Calculated Molecular Weight | 232 aa, 25 kDa |
Observed Molecular Weight | 20 kDa |
GenBank Accession Number | BC113441 |
Gene Symbol | MIXL1 |
Gene ID (NCBI) | 83881 |
RRID | AB_2879164 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | Q9H2W2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Mix1 homeobox-like 1 (MIXL1) Transcription factor that play a central role in proper axial mesendoderm morphogenesis and endoderm formation. Required for efficient differentiation of cells from the primitive streak stage to blood, by acting early in the recruitment and/or expansion of mesodermal progenitors to the hemangioblastic and hematopoietic lineages. Also involved in the morphogenesis of the heart and the gut during embryogenesis. Acts as a negative regulator of brachyury expression. This antibody is specific to MIXL1.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MIXL1 antibody 22772-1-AP | Download protocol |
IF protocol for MIXL1 antibody 22772-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Stem Cell Generation of Human PSC-Derived Kidney Organoids with Patterned Nephron Segments and a De Novo Vascular Network. | ||
Cell Death Differ Uric acid: a potent molecular contributor to pluripotent stem cell cardiac differentiation via mesoderm specification. | ||
Front Cell Dev Biol Species origin of exogenous transcription factors affects the activation of endogenous pluripotency markers and signaling pathways of porcine induced pluripotent stem cells | ||
STAR Protoc Accelerated protocol for the differentiation of podocytes from human pluripotent stem cells. |