MIXL1 Polyclonal antibody

• 

  WB analysis of HEK-293 using 22772-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 22772-1-AP (MIXL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat pancreas using 22772-1-AP

  rat pancreas tissue were subjected to SDS PAGE followed by western blot with 22772-1-AP (MIXL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of H7ES using 22772-1-AP

  H7ES cells were subjected to SDS PAGE followed by western blot with 22772-1-AP (MIXL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 22772-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HEK-293 cells using 22772-1-AP (MIXL1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

MIXL1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 22772-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

MIX1 homeobox-like protein 1, Mix.1 homeobox-like protein, MIX, MILD1, Homeobox protein MIXL1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, rat pancreas tissue
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 6 publications below

Product Information

22772-1-AP targets MIXL1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18732

  Product name: Recombinant human MIXL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 147-232 aa of BC113441

  Sequence: KSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF

• Full Name: Mix1 homeobox-like 1 (Xenopus laevis)
• Calculated Molecular Weight: 232 aa, 25 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC113441
• Gene Symbol: MIXL1
• Gene ID (NCBI): 83881
• RRID: AB_2879164
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9H2W2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mix1 homeobox-like 1 (MIXL1) Transcription factor that play a central role in proper axial mesendoderm morphogenesis and endoderm formation. Required for efficient differentiation of cells from the primitive streak stage to blood, by acting early in the recruitment and/or expansion of mesodermal progenitors to the hemangioblastic and hematopoietic lineages. Also involved in the morphogenesis of the heart and the gut during embryogenesis. Acts as a negative regulator of brachyury expression. This antibody is specific to MIXL1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell Stem Cell; Generation of Human PSC-Derived Kidney Organoids with Patterned Nephron Segments and a De Novo Vascular Network.; Authors - Jian Hui Low
human	IF	Adv Healthc Mater; Spatial Stem Cell Fate Engineering via Facile Morphogen Localization; Authors - Gyuhyung Jin
		Cell Death Differ; Uric acid: a potent molecular contributor to pluripotent stem cell cardiac differentiation via mesoderm specification.; Authors - Bingbing Ke
human	IF	Int J Mol Sci; Porcine Kidney Organoids Derived from Naïve-like Embryonic Stem Cells; Authors - Meishuang Li
pig	IF	Front Cell Dev Biol; Species origin of exogenous transcription factors affects the activation of endogenous pluripotency markers and signaling pathways of porcine induced pluripotent stem cells; Authors - Meng Zhou
human	IF	STAR Protoc; Accelerated protocol for the differentiation of podocytes from human pluripotent stem cells.; Authors - Julie Bejoy