Use Able AI chat for product recommendations

MMP1 Polyclonal antibody

MMP1 Polyclonal Antibody for WB, IP, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IP, ELISA

CLG, CLGN, Fibroblast collagenase, Interstitial collagenase, Matrix metalloproteinase 1, MMP 1, MMP1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for MMP1 in ?

Tested Applications

Positive WB detected inA375 cells, NIH/3T3 cells
Positive IP detected inRaji cells
Positive IHC detected inhuman cervical cancer tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26585-1-AP targets MMP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25073

Product name: Recombinant human MMP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 428-469 aa of BC013875

Sequence: AVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Predict reactive species
Full Name matrix metallopeptidase 1 (interstitial collagenase)
Calculated Molecular Weight 54 kDa
Observed Molecular Weight 62 kDa
GenBank Accession NumberBC013875
Gene Symbol MMP1
Gene ID (NCBI) 4312
RRIDAB_2880564
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP03956
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP1, also named as CLG, belongs to the peptidase M10A family. MMP is the main enzyme that cleaves fibrillar collagen, namely types I, II, III, VII, and X.It is involved in cell migration and invasion, and is frequently up-regulated in cancer cells. It can be cleavage to two major forms (22 kDa and 27 kDa) by undergoing autolytic,and the minor form (25 kDa) is the glycosylated form of the 22 kDa form. The 27 kDa form has no activity while the 22/25 kDa form can act as activator for collagenase.The sizes of pro-MMP-1 and active MMP-1 from human synovial fibroblasts have been reported as 52 to 56 kDa, depending on glycosylation, and 41 to 45 kDa, respectively.In addition ,a band of 62-kDa observed in the current study is pro-MMp-1(PMID:9418730).

Protocols

Product Specific Protocols
IHC protocol for MMP1 antibody 26585-1-APDownload protocol
IP protocol for MMP1 antibody 26585-1-APDownload protocol
WB protocol for MMP1 antibody 26585-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The MMP1 Polyclonal antibody (Cat# 26585-1-AP) has 10 citations published in journals including Phytomedicine, International Journal of Biological Macromolecules, International Journal of Molecular Sciences, Molecular Medicine Reports, Scientific Reports, Journal of Cellular and Molecular Medicine, Breast Cancer Research and Treatment, Frontiers in Genetics, PLoS ONE, and Journal of Theoretical Biology. Research fields span rheumatoid arthritis, skin aging, mammary gland inflammation, chondrosarcoma, intracranial aneurysm, kidney fibrosis, breast cancer metastasis, osteoarthritis, hepatic fibrosis, and chronic wound healing.

SpeciesApplicationTitle
human, ratWB

Phytomedicine

NOX2 inhibitor baicalein alleviates rheumatoid arthritis and inactivating mitochondrial oxidative stress-mediated cGAS-STING signaling in fibroblast-like synoviocytes.

Authors - Rui Wang
WB

Int J Biol Macromol

Peroxisome Proliferator-Activated Receptor Gamma (PPARγ)-targeted Gel/Mg/Lip@Gigantol nanoplatform attenuates skin barrier disruption-associated aging in mice via NLRP3 suppression

Authors - Xiaorong Jia
bovineWB

Int J Mol Sci

Impact of Escherichia coli and Lipopolysaccharide on the MAPK Signaling Pathway, MMPs, TIMPs, and the uPA System in Bovine Mammary Epithelial Cells

Authors - Yuanyuan Zhang

Mol Med Rep

Icariin inhibits MMP‑1, MMP‑3 and MMP‑13 expression through MAPK pathways in IL‑1β‑stimulated SW1353 chondrosarcoma cells.

Authors - Li Zeng
ratWB

Sci Rep

WNTA5-mediated miR-374a-5p regulates vascular smooth muscle cell phenotype transformation and M1 macrophage polarization impacting intracranial aneurysm progression

Authors - Zengshi Li
mouseWB

J Cell Mol Med

p16INK4a Deletion Alleviated Obesity-Associated Kidney Fibrosis by Regulating Metabolic Reprogramming and the Inflammasome Pathway

Authors - Qian Liu
Loading...
||
New chat

Able™

正在加载,请稍候...