MMP1 Polyclonal antibody

MMP1 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 26585-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IP, ELISA

CLG, CLGN, Fibroblast collagenase, Interstitial collagenase, Matrix metalloproteinase 1, MMP 1, MMP1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, NIH/3T3 cells
Positive IP detected inRaji cells
Positive IHC detected inhuman cervical cancer tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26585-1-AP targets MMP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25073

Product name: Recombinant human MMP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 428-469 aa of BC013875

Sequence: AVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Predict reactive species
Full Name matrix metallopeptidase 1 (interstitial collagenase)
Calculated Molecular Weight 54 kDa
Observed Molecular Weight 62 kDa
GenBank Accession NumberBC013875
Gene Symbol MMP1
Gene ID (NCBI) 4312
RRIDAB_2880564
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP03956
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP1, also named as CLG, belongs to the peptidase M10A family. MMP is the main enzyme that cleaves fibrillar collagen, namely types I, II, III, VII, and X.It is involved in cell migration and invasion, and is frequently up-regulated in cancer cells. It can be cleavage to two major forms (22 kDa and 27 kDa) by undergoing autolytic,and the minor form (25 kDa) is the glycosylated form of the 22 kDa form. The 27 kDa form has no activity while the 22/25 kDa form can act as activator for collagenase.The sizes of pro-MMP-1 and active MMP-1 from human synovial fibroblasts have been reported as 52 to 56 kDa, depending on glycosylation, and 41 to 45 kDa, respectively.In addition ,a band of 62-kDa observed in the current study is pro-MMp-1(PMID:9418730).

Protocols

Product Specific Protocols
IHC protocol for MMP1 antibody 26585-1-APDownload protocol
IP protocol for MMP1 antibody 26585-1-APDownload protocol
WB protocol for MMP1 antibody 26585-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseWB,IHC,IP

Breast Cancer Res Treat

Exosomal MMP-1 transfers metastasis potential in triple-negative breast cancer through PAR1-mediated EMT.

Authors - Yihui Zhu
humanWB

Front Genet

Exhausting circ_0136474 and Restoring miR-766-3p Attenuate Chondrocyte Oxidative Injury in IL-1β-Induced Osteoarthritis Progression Through Regulating DNMT3A.

Authors - Haiquan Zhu

Mol Med Rep

Icariin inhibits MMP‑1, MMP‑3 and MMP‑13 expression through MAPK pathways in IL‑1β‑stimulated SW1353 chondrosarcoma cells.

Authors - Li Zeng
WB

Int J Biol Macromol

Peroxisome Proliferator-Activated Receptor Gamma (PPARγ)-targeted Gel/Mg/Lip@Gigantol nanoplatform attenuates skin barrier disruption-associated aging in mice via NLRP3 suppression

Authors - Xiaorong Jia
mouseWB

J Cell Mol Med

p16INK4a Deletion Alleviated Obesity-Associated Kidney Fibrosis by Regulating Metabolic Reprogramming and the Inflammasome Pathway

Authors - Qian Liu
bovineWB

Int J Mol Sci

Impact of Escherichia coli and Lipopolysaccharide on the MAPK Signaling Pathway, MMPs, TIMPs, and the uPA System in Bovine Mammary Epithelial Cells

Authors - Yuanyuan Zhang
Loading...
||
New chat

Able

正在加载,请稍候...