Tested Applications
| Positive WB detected in | A375 cells, NIH/3T3 cells |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human cervical cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IP | See 1 publications below |
Product Information
26585-1-AP targets MMP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25073 Product name: Recombinant human MMP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 428-469 aa of BC013875 Sequence: AVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN Predict reactive species |
| Full Name | matrix metallopeptidase 1 (interstitial collagenase) |
| Calculated Molecular Weight | 54 kDa |
| Observed Molecular Weight | 62 kDa |
| GenBank Accession Number | BC013875 |
| Gene Symbol | MMP1 |
| Gene ID (NCBI) | 4312 |
| RRID | AB_2880564 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P03956 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MMP1, also named as CLG, belongs to the peptidase M10A family. MMP is the main enzyme that cleaves fibrillar collagen, namely types I, II, III, VII, and X.It is involved in cell migration and invasion, and is frequently up-regulated in cancer cells. It can be cleavage to two major forms (22 kDa and 27 kDa) by undergoing autolytic,and the minor form (25 kDa) is the glycosylated form of the 22 kDa form. The 27 kDa form has no activity while the 22/25 kDa form can act as activator for collagenase.The sizes of pro-MMP-1 and active MMP-1 from human synovial fibroblasts have been reported as 52 to 56 kDa, depending on glycosylation, and 41 to 45 kDa, respectively.In addition ,a band of 62-kDa observed in the current study is pro-MMp-1(PMID:9418730).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MMP1 antibody 26585-1-AP | Download protocol |
| IP protocol for MMP1 antibody 26585-1-AP | Download protocol |
| WB protocol for MMP1 antibody 26585-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Breast Cancer Res Treat Exosomal MMP-1 transfers metastasis potential in triple-negative breast cancer through PAR1-mediated EMT. | ||
Front Genet Exhausting circ_0136474 and Restoring miR-766-3p Attenuate Chondrocyte Oxidative Injury in IL-1β-Induced Osteoarthritis Progression Through Regulating DNMT3A. | ||
Mol Med Rep Icariin inhibits MMP‑1, MMP‑3 and MMP‑13 expression through MAPK pathways in IL‑1β‑stimulated SW1353 chondrosarcoma cells. | ||
Int J Mol Sci Impact of Escherichia coli and Lipopolysaccharide on the MAPK Signaling Pathway, MMPs, TIMPs, and the uPA System in Bovine Mammary Epithelial Cells | ||
J Cell Mol Med p16INK4a Deletion Alleviated Obesity-Associated Kidney Fibrosis by Regulating Metabolic Reprogramming and the Inflammasome Pathway | ||
Sci Rep WNTA5-mediated miR-374a-5p regulates vascular smooth muscle cell phenotype transformation and M1 macrophage polarization impacting intracranial aneurysm progression |













