MPP7 Polyclonal antibody, PBS Only

• 

  WB analysis using 12983-1-AP (same clone as 12983-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12983-1-AP (MPP7 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12983-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 12983-1-AP (same clone as 12983-1-PBS)

  IP result of anti-MPP7 (IP:12983-1-AP, 4ug; Detection:12983-1-AP 1:500) with HeLa cells lysate 2800ug. This data was developed using the same antibody clone with 12983-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 12983-1-AP (same clone as 12983-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 12983-1-AP (MPP7 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 12983-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MPP7 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12983-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

MAGUK p55 subfamily member 7

---

Product Information

12983-1-PBS targets MPP7 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3612

  Product name: Recombinant human MPP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 269-576 aa of BC038105

  Sequence: DATWWQAKHEADANPRAGLIPSKHFQERRLALRRPEILVQPLKVSNRKSSGFRRSFRLSRKDKKTNKSMYECKKSDQYDTADVPTYEEVTPYRRQTNEKYRLVVLVGPVGVGLNELKRKLLISDTQHYGVTVPHTTRARRSQESDGVEYIFISKHLFETDVQNNKFIEYGEYKNNYYGTSIDSVRSVLAKNKVCLLDVQPHTVKHLRTLEFKPYVIFIKPPSIERLRETRKNAKIISSRDDQGAAKPFTEEDFQEMIKSAQIMESQYGHLFDKIIINDDLTVAFNELKTTFDKLETETHWVPVSWLHS

• Full Name: membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7)
• Calculated Molecular Weight: 576 aa, 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC038105
• Gene Symbol: MPP7
• Gene ID (NCBI): 143098
• RRID: AB_2291710
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T2T1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.