MRPL23 Monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 66595-1-Ig (same clone as 66595-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66595-1-Ig (MRPL23 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66595-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66595-1-Ig (same clone as 66595-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66595-1-Ig (MRPL23 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66595-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66595-1-Ig (same clone as 66595-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66595-1-Ig (MRPL23 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66595-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 66595-1-Ig (same clone as 66595-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using 66595-1-Ig (MRPL23 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66595-1-PBS in a different storage buffer formulation.

MRPL23 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66595-1-PBS

Clone No.1G11C4

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

L23MRP, L23mt, MRP L23, MRPL23, Ribosomal protein L23 like, RPL23, RPL23L

---

Product Information

66595-1-PBS targets MRPL23 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2220

  Product name: Recombinant human MRPL23 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-153 aa of BC027710

  Sequence: MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL

• Full Name: mitochondrial ribosomal protein L23
• Calculated Molecular Weight: 153 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC027710
• Gene Symbol: MRPL23
• Gene ID (NCBI): 6150
• RRID: AB_2881955
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16540
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.