Tested Applications
| Positive WB detected in | HEK-293 cells | 
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HEK-293 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 | 
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66595-1-Ig targets MRPL23 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human | 
| Host / Isotype | Mouse / IgG2a | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag2220 Product name: Recombinant human MRPL23 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 1-153 aa of BC027710 Sequence: MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL Predict reactive species | 
                                    
| Full Name | mitochondrial ribosomal protein L23 | 
| Calculated Molecular Weight | 153 aa, 18 kDa | 
| Observed Molecular Weight | 18 kDa | 
| GenBank Accession Number | BC027710 | 
| Gene Symbol | MRPL23 | 
| Gene ID (NCBI) | 6150 | 
| RRID | AB_2881955 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | Q16540 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MRPL23 antibody 66595-1-Ig | Download protocol | 
| IHC protocol for MRPL23 antibody 66595-1-Ig | Download protocol | 
| WB protocol for MRPL23 antibody 66595-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 







