MRPL35 Polyclonal antibody, PBS Only

• 

  WB analysis using 27339-1-AP (same clone as 27339-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27339-1-AP (MRPL35 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27339-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 27339-1-AP (same clone as 27339-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MRPL35 antibody (27339-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 27339-1-PBS in a different storage buffer formulation.

MRPL35 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 27339-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

MRPL 35, MRP L35, L35mt

---

Product Information

27339-1-PBS targets MRPL35 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26300

  Product name: Recombinant human MRPL35 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 61-170 aa of BC020651

  Sequence: TTSERNLTCGHTSVILNRMAPVLPSVLKLPVRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKAGYKKKLWKKTPARKKRLREFVFCNKTQSKLLDKMTTSFWKRRN

• Full Name: mitochondrial ribosomal protein L35
• Calculated Molecular Weight: 170 aa, 19 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC020651
• Gene Symbol: MRPL35
• Gene ID (NCBI): 51318
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZE8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mitochondrial ribosomal protein L35 (MRPL35) is a member of the large subunit family of mitochondrial ribosomal proteins. It plays a key role in the assembly of cytochrome C oxidase, involved in the translation of mitochondrial proteins.