Tested Applications
| Positive WB detected in | mouse liver tissue, human heart tissue, mouse ovary tissue, mouse uterus tissue |
| Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 12 publications below |
| IHC | See 1 publications below |
Product Information
15190-1-AP targets MRPL37 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7276 Product name: Recombinant human MRPL37 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 118-423 aa of BC000041 Sequence: KQALWLTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHPSLARRICVQNSTFSATWNRESLLLQVRGSGGARLSTKDPLPTIASREEIEATKNHVLETFYPISPIIDLHECNIYDVKNDTGFQEGYPYPYPHTLYLLDKANLRPHRLQPDQLRAKMILFAFGSALAQARLLYGNDAKVLEQPVVVQSVGTDGRVFHFLVFQLNTTDLDCNEGVKNLAWVDSDQLLYQHFWCLPVIKKRVVVEPVGPVGFKPETFRKFLALYLHGAA Predict reactive species |
| Full Name | mitochondrial ribosomal protein L37 |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 48 kDa |
| GenBank Accession Number | BC000041 |
| Gene Symbol | MRPL37 |
| Gene ID (NCBI) | 51253 |
| RRID | AB_2146040 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BZE1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MRPL37 antibody 15190-1-AP | Download protocol |
| WB protocol for MRPL37 antibody 15190-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Sci Adv Fidelity of translation initiation is required for coordinated respiratory complex assembly. | ||
EMBO J Stress signaling and cellular proliferation reverse the effects of mitochondrial mistranslation. | ||
Aging Cell Mitochondrial mistranslation modulated by metabolic stress causes cardiovascular disease and reduced lifespan. | ||
Am J Hum Genet Biallelic Mutations in MRPS34 Lead to Instability of the Small Mitoribosomal Subunit and Leigh Syndrome. | ||
EMBO Rep Concerted regulation of mitochondrial and nuclear non-coding RNAs by a dual-targeted RNase Z. |





















