MRPL37 Polyclonal antibody

• 

  WB analysis of mouse liver using 15190-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15190-1-AP (MRPL37 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 15190-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15190-1-AP (MRPL37 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse ovary using 15190-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 15190-1-AP (MRPL37 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse uterus using 15190-1-AP

  mouse uterus tissue were subjected to SDS PAGE followed by western blot with 15190-1-AP (MRPL37 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 15190-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 15190-1-AP (MRPL37 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 15190-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 15190-1-AP (MRPL37 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lymphoma using 15190-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 15190-1-AP (MRPL37 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 15190-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 15190-1-AP (MRPL37 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 15190-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 15190-1-AP (MRPL37 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lymphoma using 15190-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 15190-1-AP (MRPL37 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 15190-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 15190-1-AP (MRPL37 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MRPL37 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15190-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

L2mt, L37mt, MRP L2, MRP L37, MRPL2, MRPL37, RPML2

---

Tested Applications

• Positive WB detected in: mouse liver tissue, human heart tissue, mouse ovary tissue, mouse uterus tissue
• Positive IHC detected in: human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 12 publications below
• IHC: See 1 publications below

Product Information

15190-1-AP targets MRPL37 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7276

  Product name: Recombinant human MRPL37 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 118-423 aa of BC000041

  Sequence: KQALWLTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHPSLARRICVQNSTFSATWNRESLLLQVRGSGGARLSTKDPLPTIASREEIEATKNHVLETFYPISPIIDLHECNIYDVKNDTGFQEGYPYPYPHTLYLLDKANLRPHRLQPDQLRAKMILFAFGSALAQARLLYGNDAKVLEQPVVVQSVGTDGRVFHFLVFQLNTTDLDCNEGVKNLAWVDSDQLLYQHFWCLPVIKKRVVVEPVGPVGFKPETFRKFLALYLHGAA

• Full Name: mitochondrial ribosomal protein L37
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC000041
• Gene Symbol: MRPL37
• Gene ID (NCBI): 51253
• RRID: AB_2146040
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZE1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Sci Adv; Adult-onset obesity is triggered by impaired mitochondrial gene expression.; Authors - Kara L Perks
mouse	WB	Sci Adv; Fidelity of translation initiation is required for coordinated respiratory complex assembly.; Authors - Danielle L Rudler
mouse	WB	EMBO J; Stress signaling and cellular proliferation reverse the effects of mitochondrial mistranslation.; Authors - Nicola Ferreira
mouse	WB	Aging Cell; Mitochondrial mistranslation modulated by metabolic stress causes cardiovascular disease and reduced lifespan.; Authors - Tara R Richman
human	WB	Am J Hum Genet; Biallelic Mutations in MRPS34 Lead to Instability of the Small Mitoribosomal Subunit and Leigh Syndrome.; Authors - Nicole J Lake
mouse	WB	EMBO Rep; Concerted regulation of mitochondrial and nuclear non-coding RNAs by a dual-targeted RNase Z.; Authors - Stefan J Siira