MRPS17 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MRPS17 Polyclonal antibody (18881-1-AP)

MRPS17 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18881-1-AP Copied!

Publications (18)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

Synonyms

HSPC011, MRP S17, MRPS 17, MRP-S17, RPMS17

• 

  WB analysis using 18881-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18881-1-AP (MRPS17 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 18881-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18881-1-AP (MRPS17 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 18881-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18881-1-AP (MRPS17 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 18881-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MRPS17 antibody (18881-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MRPS17 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18881-1-AP targets MRPS17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13414

  Product name: Recombinant human MRPS17 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-130 aa of BC054031

  Sequence: MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ

• Full Name: mitochondrial ribosomal protein S17
• Calculated Molecular Weight: 130 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC054031
• Gene Symbol: MRPS17
• Gene ID (NCBI): 51373
• RRID: AB_10597844
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2R5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MRPS17 polyclonal antibody (Cat# 18881-1-AP) has 18 citations. Publications appear in journals including Science, Molecular Cell, Nucleic Acids Research, Nature Structural & Molecular Biology, Cell Reports, JCI Insight, RNA Biology, Journal of Cell Science, PLoS Genetics, Journal of Cancer, Human Genetics, Human Molecular Genetics, STAR Protocols, bioRxiv, Methods in Molecular Biology, and Journal of Molecular Histology. Research fields span mitochondrial ribosome biogenesis and assembly, mitochondrial diseases, cancer (gastric and lung), and developmental biology.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Science; Ubiquitin-mediated mitophagy regulates the inheritance of mitochondrial DNA mutations; Authors - Michele Frison
human	WB	Mol Cell; Identification of TMEM126A as OXA1L-interacting protein reveals cotranslational quality control in mitochondria; Authors - Sabine Poerschke
human	WB	Nucleic Acids Res; MPV17L2 is required for ribosome assembly in mitochondria.; Authors - Ilaria Dalla Rosa
human	WB	Nucleic Acids Res; Transcription-independent role for human mitochondrial RNA polymerase in mitochondrial ribosome biogenesis.; Authors - Surovtseva Yulia V YV
human	WB	Nucleic Acids Res; METTL15 introduces N4-methylcytidine into human mitochondrial 12S rRNA and is required for mitoribosome biogenesis.; Authors - Lindsey Van Haute
human	WB	Nat Struct Mol Biol; A roadmap for ribosome assembly in human mitochondria; Authors - Elena Lavdovskaia