MRPS17 Polyclonal antibody

• 

  WB analysis using 18881-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18881-1-AP (MRPS17 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 18881-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18881-1-AP (MRPS17 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 18881-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18881-1-AP (MRPS17 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 18881-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MRPS17 antibody (18881-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

MRPS17 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18881-1-AP

Publications(16)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HSPC011, MRP S17, MRPS17, RPMS17, S17mt

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 14 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

18881-1-AP targets MRPS17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13414

  Product name: Recombinant human MRPS17 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-130 aa of BC054031

  Sequence: MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ

• Full Name: mitochondrial ribosomal protein S17
• Calculated Molecular Weight: 130 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC054031
• Gene Symbol: MRPS17
• Gene ID (NCBI): 51373
• RRID: AB_10597844
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2R5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Identification of TMEM126A as OXA1L-interacting protein reveals cotranslational quality control in mitochondria; Authors - Sabine Poerschke
human	WB	Nucleic Acids Res; METTL15 introduces N4-methylcytidine into human mitochondrial 12S rRNA and is required for mitoribosome biogenesis.; Authors - Lindsey Van Haute
human	WB	Nucleic Acids Res; Transcription-independent role for human mitochondrial RNA polymerase in mitochondrial ribosome biogenesis.; Authors - Surovtseva Yulia V YV
human	WB	Nucleic Acids Res; MPV17L2 is required for ribosome assembly in mitochondria.; Authors - Ilaria Dalla Rosa
human	WB	PLoS Genet; RCC1L (WBSCR16) isoforms coordinate mitochondrial ribosome assembly through their interaction with GTPases.; Authors - Aurelio Reyes
human	WB	RNA Biol; TRMT2B is responsible for both tRNA and rRNA m5U-methylation in human mitochondria.; Authors - Christopher A Powell