Tested Applications
Positive IHC detected in | human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
16359-1-AP targets MRPS21 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8343 Product name: Recombinant human MRPS21 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC004566 Sequence: MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRRRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC Predict reactive species |
Full Name | mitochondrial ribosomal protein S21 |
Calculated Molecular Weight | 87 aa, 11 kDa |
GenBank Accession Number | BC004566 |
Gene Symbol | MRPS21 |
Gene ID (NCBI) | 54460 |
RRID | AB_2180349 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P82921 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for MRPS21 antibody 16359-1-AP | Download protocol |
IHC protocol for MRPS21 antibody 16359-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |