MRPS21 Polyclonal antibody

MRPS21 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 16359-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Small ribosomal subunit protein bS21m, S21mt, RPMS21, MRP-S21, MRP S21

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllIHCIF/ICC

IHC staining of human pancreas using 16359-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 16359-1-AP (MRPS21 antibody) at dilution of 1:200 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas using 16359-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 16359-1-AP (MRPS21 antibody) at dilution of 1:200 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 16359-1-AP
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MRPS21 antibody (16359-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Positive IHC detected in	human pancreas tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

16359-1-AP targets MRPS21 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag8343 Product name: Recombinant human MRPS21 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC004566 Sequence: MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRRRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC Predict reactive species
Full Name	mitochondrial ribosomal protein S21
Calculated Molecular Weight	87 aa, 11 kDa
GenBank Accession Number	BC004566
Gene Symbol	MRPS21
Gene ID (NCBI)	54460
RRID	AB_2180349
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P82921
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Product Specific Protocols
IF protocol for MRPS21 antibody 16359-1-AP	Download protocol
IHC protocol for MRPS21 antibody 16359-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Species	Application	Title
	WB	Signal Transduct Target Ther Fructose directly remodels the translocase of the outer membrane to impair oxidative phosphorylation in podocytes Authors - Wenyuan Wu View Article