MRPS21 Polyclonal antibody

• 

  IHC staining of human pancreas using 16359-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 16359-1-AP (MRPS21 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human pancreas using 16359-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 16359-1-AP (MRPS21 antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HepG2 using 16359-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MRPS21 antibody (16359-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

MRPS21 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 16359-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, ELISA

Synonyms

Small ribosomal subunit protein bS21m, S21mt, RPMS21, MRP-S21, MRP S21

---

Tested Applications

• Positive IHC detected in: human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16359-1-AP targets MRPS21 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8343

  Product name: Recombinant human MRPS21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-87 aa of BC004566

  Sequence: MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRRRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC

• Full Name: mitochondrial ribosomal protein S21
• Calculated Molecular Weight: 87 aa, 11 kDa
• GenBank Accession Number: BC004566
• Gene Symbol: MRPS21
• Gene ID (NCBI): 54460
• RRID: AB_2180349
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P82921
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.