CoraLite®594-conjugated MSH6 Monoclonal antibody

• 

  FC experiment of HEK-293 using CL594-66172

  1X10^6 HEK-293 cells were intracellularly stained with 0.4 ug CoraLite®594 Anti-Human MSH6 (CL594-66172, Clone:2E10B2) (red), or 0.4 ug Mouse IgG2a Isotype Control (CL594-66360-2, Clone: K11A1B2A2) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

MSH6 Monoclonal Antibody for FC (Intra)

Cat No. CL594-66172

Clone No.2E10B2

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

FC (Intra)

Synonyms

hMSH6, GTMBP, GTBP, G/T mismatch-binding protein, G/T mismatch binding protein

---

Tested Applications

• Positive FC (Intra) detected in: HEK-293 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66172 targets MSH6 in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12645

  Product name: Recombinant human MSH6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-400 aa of BC004246

  Sequence: MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPE

• Full Name: mutS homolog 6 (E. coli)
• Calculated Molecular Weight: 153 kDa
• GenBank Accession Number: BC004246
• Gene Symbol: MSH6
• Gene ID (NCBI): 2956
• RRID: AB_2919958
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P52701
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

MSH6, also named as DNA mismatch repair protein Msh6 or GTMBP, is a 1360 amino acid protein, which contains one PWWP domain and belongs to the DNA mismatch repair MutS family. MSH6 localizes in the nucleus and is a component of the post-replicative DNA mismatch repair system. Msh2 and Msh6 form a protein complex required to repair mismatches generated during DNA replication.