MSI1 Polyclonal antibody

• 

  WB analysis using 27185-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27185-1-AP (MSI1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Caco-2 using 27185-1-AP

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 27185-1-AP (MSI1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293T using 27185-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 27185-1-AP (MSI1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human gliomas using 27185-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 27185-1-AP (MSI1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 27185-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 27185-1-AP (MSI1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MSI1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27185-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

MSI1, Musashi 1, musashi homolog 1 (Drosophila)

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Caco-2 cells, HEK-293T cells
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 1 publications below

Product Information

27185-1-AP targets MSI1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26042

  Product name: Recombinant human MSI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-83 aa of BC146463

  Sequence: METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRH

• Full Name: musashi homolog 1 (Drosophila)
• Calculated Molecular Weight: 362 aa, 39 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC146463
• Gene Symbol: MSI1
• Gene ID (NCBI): 4440
• RRID: AB_2880790
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43347
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Musashi1 (Msi1) is an RNA-binding protein expressed in neural progenitor cells and neural stem cells. The gene encoding human Msi1 encodes a 362 amino acid protein. In murine embryonic neural progenitor cells, Msi1 localizes to the cytoplasm and is downregulated during differentiation. Msi1 binds to NUMB, which encodes a membrane-associated antagonist of Notch signaling. Msi1 appears to function in the proliferation and maintenance of stem cell populations of the central nervous system. In addition to its usefulness as a marker for neural progenitor cells in normal human brains, Msi1 is also a marker for human gliomas. In rats, Msi1 is expressed in Sertoli cells of the testis and granulosa cells of the ovary.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Oncol; Effects of three-dimensional collagen scaffolds on the expression profiles and biological functions of glioma cells.; Authors - Wei Jia
human	IF	Front Mol Neurosci; Importin-Mediated Pathological Tau Nuclear Translocation Causes Disruption of the Nuclear Lamina, TDP-43 Mislocalization and Cell Death.; Authors - Robert F Candia
human	WB	J Cancer; PMID: 31031868; Authors - Huaizeng Chen
human	WB	Oncogene; Alternative splicing of ALDOA confers tamoxifen resistance in breast cancer; Authors - Shiyi Yu