MSI1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MSI1 Polyclonal antibody (27185-1-AP)

MSI1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27185-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

MSI1, Musashi 1, musashi homolog 1 (Drosophila)

• 

  WB analysis using 27185-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27185-1-AP (MSI1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Caco-2 using 27185-1-AP

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 27185-1-AP (MSI1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293T using 27185-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 27185-1-AP (MSI1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 27185-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 27185-1-AP (MSI1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 27185-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 27185-1-AP (MSI1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MSI1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Caco-2 cells, HEK-293T cells
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27185-1-AP targets MSI1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26042

  Product name: Recombinant human MSI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-83 aa of BC146463

  Sequence: METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRH

• Full Name: musashi homolog 1 (Drosophila)
• Calculated Molecular Weight: 362 aa, 39 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC146463
• Gene Symbol: MSI1
• Gene ID (NCBI): 4440
• RRID: AB_2880790
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43347
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Musashi1 (Msi1) is an RNA-binding protein expressed in neural progenitor cells and neural stem cells. The gene encoding human Msi1 encodes a 362 amino acid protein. In murine embryonic neural progenitor cells, Msi1 localizes to the cytoplasm and is downregulated during differentiation. Msi1 binds to NUMB, which encodes a membrane-associated antagonist of Notch signaling. Msi1 appears to function in the proliferation and maintenance of stem cell populations of the central nervous system. In addition to its usefulness as a marker for neural progenitor cells in normal human brains, Msi1 is also a marker for human gliomas. In rats, Msi1 is expressed in Sertoli cells of the testis and granulosa cells of the ovary.

Publications

What published studies show

The MSI1 polyclonal antibody (Cat# 27185-1-AP) has 4 total citations. These appear in Oncogene, International Journal of Oncology, Frontiers in Molecular Neuroscience, and Journal of Cancer. The associated research fields include breast cancer (tamoxifen resistance via ALDOA alternative splicing), glioma biology (3D collagen scaffold effects on cell expression profiles), neurodegeneration (importin-mediated tau nuclear translocation and nuclear lamina disruption), and ovarian carcinoma (Musashi-1 inhibition reversing paclitaxel resistance). All studies used human samples with WB or IF applications.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncogene; Alternative splicing of ALDOA confers tamoxifen resistance in breast cancer; Authors - Shiyi Yu
human	WB	Int J Oncol; Effects of three-dimensional collagen scaffolds on the expression profiles and biological functions of glioma cells.; Authors - Wei Jia
human	IF	Front Mol Neurosci; Importin-Mediated Pathological Tau Nuclear Translocation Causes Disruption of the Nuclear Lamina, TDP-43 Mislocalization and Cell Death.; Authors - Robert F Candia
human	WB	J Cancer; PMID: 31031868; Authors - Huaizeng Chen