MTA1 Polyclonal antibody

• 

  WB analysis using 30545-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30545-1-AP (MTA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30545-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30545-1-AP (MTA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 30545-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 30545-1-AP (MTA1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 30545-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 30545-1-AP (MTA1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin cancer using 30545-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 30545-1-AP (MTA1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin cancer using 30545-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 30545-1-AP (MTA1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat cerebellum using 30545-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 30545-1-AP (MTA1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat cerebellum using 30545-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 30545-1-AP (MTA1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 30545-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using MTA1 antibody (30545-1-AP) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

MTA1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30545-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MTA 1, metastasis associated 1

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, NIH/3T3 cells, HEK-293T cells, MCF-7 cells
• Positive IHC detected in: human prostate cancer tissue, human skin cancer tissue, rat cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

30545-1-AP targets MTA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30994

  Product name: Recombinant human MTA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 513-678 aa of NM_004689

  Sequence: TARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETK

• Full Name: metastasis associated 1
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: NM_004689
• Gene Symbol: MTA1
• Gene ID (NCBI): 9112
• RRID: AB_3086358
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13330
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Metastasis-associated protein 1 (MTA1) is a member of the MTA family which is involved in regulating DNA-based biological processes (PMID: 25332144). MTA1 is an integral part of nucleosome remodeling histone deacetylase complex (NuRD complex) and regulates nucleosome remodeling and deacetylation by stabilizing the NuRD complex and related proteins(PMID: 12419236). MTA1 expression is associated with tumor malignancy in several cancer.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	bioRxiv; Cancer-associated snaR-A noncoding RNA interacts with core splicing machinery and disrupts processing of mRNA subpopulations; Authors - Sihang Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Vasudevarao (Verified Customer) (08-25-2025)

This is an excellent antibody, highly suitable for immunoprecipitation, immunoblotting, IHC, and IF. It performs very well across all these applications

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Flow Cytometry, Cell culture, ChIP, Protein purification
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Breast Cancer cells