MTCL2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MTCL2 Polyclonal antibody, PBS Only (33016-1-PBS)

• 

  WB analysis using 33016-1-AP (same clone as 33016-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33016-1-AP (C20orf117 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33016-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 33016-1-AP (same clone as 33016-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 33016-1-AP (C20orf117 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33016-1-PBS in a different storage buffer formulation.

MTCL2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33016-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

80-kDa SOGA fragment, C20orf117, C-terminal 80 kDa form, KIAA0889, Microtubule cross-linking factor 2

---

Product Information

33016-1-PBS targets MTCL2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35888

  Product name: Recombinant human C20orf117 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1200-1423 aa of NM_080627

  Sequence: KYGSPKLQRRSVSKLDSSKDRSLWNLHQGKQNGSAWARSTTTRDSPVLRNINDGLSSLFSVVEHSGSTESVWKLGMSETRAKPEPPKYGIVQEFFRNVCGRAPSPTSSAGEEGTKKPEPLSPASYHQPEGVARILNKKAAKLGSSEEVRLTMLPQVGKDGVLRDGDGAVVLPNEDAVCDCSTQSLTSCFARSSRSAIRHSPSKCRLHPSESSWGGEERALPPSE

• Full Name: chromosome 20 open reading frame 117
• Calculated Molecular Weight: 159kDa
• Observed Molecular Weight: 183 kDa, 50 kDa
• GenBank Accession Number: NM_080627
• Gene Symbol: C20orf117
• Gene ID (NCBI): 140710
• RRID: AB_3742822
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O94964
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The coiled-coil protein MTCL2 preferentially acts on the perinuclear microtubules accumulated around the Golgi. MTCL2 associates with the Golgi membrane through the N-terminal coiled-coil region and directly binds microtubules through the conserved C-terminal domain without promoting microtubule stabilization. Knockdown of MTCL2 significantly impaired microtubule accumulation around the Golgi, as well as the compactness of the Golgi ribbon assembly structure. MTCL2 forms parallel oligomers through homo-interaction of the central coiled-coil motifs, and promotes asymmetric microtubule organization by crosslinking microtubules on the Golgi membrane. Results of in vitro wound healing assays further suggest that this function of MTCL2 enables integration of the centrosomal and Golgi-associated microtubules on the Golgi membrane, supporting directional migration. Additionally, the results demonstrated the involvement of CLASPs and giantin in mediating the Golgi association of MTCL2 (PMID: 35543016).