MTCL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MTCL2 Polyclonal antibody (33016-1-AP)

• 

  WB analysis using 33016-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33016-1-AP (C20orf117 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 33016-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 33016-1-AP (C20orf117 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

MTCL2 Polyclonal Antibody for WB, ELISA

Cat No. 33016-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

80-kDa SOGA fragment, C20orf117, C-terminal 80 kDa form, KIAA0889, Microtubule cross-linking factor 2

---

Tested Applications

• Positive WB detected in: HeLa cells, fetal human brain

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33016-1-AP targets MTCL2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35888

  Product name: Recombinant human C20orf117 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1200-1423 aa of NM_080627

  Sequence: KYGSPKLQRRSVSKLDSSKDRSLWNLHQGKQNGSAWARSTTTRDSPVLRNINDGLSSLFSVVEHSGSTESVWKLGMSETRAKPEPPKYGIVQEFFRNVCGRAPSPTSSAGEEGTKKPEPLSPASYHQPEGVARILNKKAAKLGSSEEVRLTMLPQVGKDGVLRDGDGAVVLPNEDAVCDCSTQSLTSCFARSSRSAIRHSPSKCRLHPSESSWGGEERALPPSE

• Full Name: chromosome 20 open reading frame 117
• Calculated Molecular Weight: 159kDa
• Observed Molecular Weight: 183 kDa, 50 kDa
• GenBank Accession Number: NM_080627
• Gene Symbol: C20orf117
• Gene ID (NCBI): 140710
• RRID: AB_3742822
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O94964
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The coiled-coil protein MTCL2 preferentially acts on the perinuclear microtubules accumulated around the Golgi. MTCL2 associates with the Golgi membrane through the N-terminal coiled-coil region and directly binds microtubules through the conserved C-terminal domain without promoting microtubule stabilization. Knockdown of MTCL2 significantly impaired microtubule accumulation around the Golgi, as well as the compactness of the Golgi ribbon assembly structure. MTCL2 forms parallel oligomers through homo-interaction of the central coiled-coil motifs, and promotes asymmetric microtubule organization by crosslinking microtubules on the Golgi membrane. Results of in vitro wound healing assays further suggest that this function of MTCL2 enables integration of the centrosomal and Golgi-associated microtubules on the Golgi membrane, supporting directional migration. Additionally, the results demonstrated the involvement of CLASPs and giantin in mediating the Golgi association of MTCL2 (PMID: 35543016).