MTHFS Polyclonal antibody

• 

  WB analysis using 13114-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13114-1-AP (MTHFS antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 13114-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13114-1-AP (MTHFS antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human stomach using 13114-1-AP

  human stomach tissue were subjected to SDS PAGE followed by western blot with 13114-1-AP (MTHFS antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 13114-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 13114-1-AP (MTHFS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 13114-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13114-1-AP (MTHFS antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 13114-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 13114-1-AP (MTHFS antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 13114-1-AP

  IP result of anti-MTHFS (IP:13114-1-AP, 4ug; Detection:13114-1-AP 1:2000) with HeLa cells lysate 1200 ug.

• 

  IHC staining of human liver cancer using 13114-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 13114-1-AP (MTHFS antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver cancer using 13114-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 13114-1-AP (MTHFS antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human liver cancer using 13114-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 13114-1-AP (MTHFS antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver cancer using 13114-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 13114-1-AP (MTHFS antibody) at dilution of 1:100 (under 40x lens).

MTHFS Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13114-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

Methenyl-THF synthetase, Methenyl THF synthetase, HsT19268, EC:6.3.3.2, 5-formyltetrahydrofolate cyclo-ligase

---

Tested Applications

• Positive WB detected in: HeLa cells, human liver tissue, Jurkat cells, human stomach tissue, U-937 cells, L02 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13114-1-AP targets MTHFS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3781

  Product name: Recombinant human MTHFS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-203 aa of BC019921

  Sequence: MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA

• Full Name: 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)
• Calculated Molecular Weight: 203 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC019921
• Gene Symbol: MTHFS
• Gene ID (NCBI): 10588
• RRID: AB_2250977
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49914
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hua (Verified Customer) (11-14-2024)

Works fine for WB.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: Moues liver

MTHFS Antibody Western Blot validation (1:2000 dilution) in Moues liver (Cat no:13114-1-AP)