MUC2 Polyclonal antibody

MUC2 Polyclonal Antibody for IHC, IF/ICC, IF-P, FC (Intra), ELISA
Cat No. 27675-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

MUC 2, MUC-2, Mucin 2, SMUC

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman colon tissue, human pancreas cancer tissue, mouse small intestine tissue, rat small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman colon tissue, mouse colon tissue, rat small intestine tissue
Positive IF/ICC detected inHepG2 cells, SW480 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.13 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27675-1-AP targets MUC2 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken, mosquito, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25800

Product name: Recombinant human MUC2 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 726-850 aa of M94132

Sequence: MYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWV

Predict reactive species
Full Name mucin 2, oligomeric mucus/gel-forming
Calculated Molecular Weight 540 kDa
GenBank Accession NumberM94132
Gene Symbol MUC2
Gene ID (NCBI) 4583
RRIDAB_2880943
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ02817
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis.

Protocols

Product Specific Protocols
IF protocol for MUC2 antibody 27675-1-APDownload protocol
IHC protocol for MUC2 antibody 27675-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Nat Commun

Dubosiella newyorkensis modulates immune tolerance in colitis via the L-lysine-activated AhR-IDO1-Kyn pathway

Authors - Yanan Zhang
mouse,humanIHC,IF

Acta Pharm Sin B

PIM1-HDAC2 axis modulates intestinal homeostasis through epigenetic modification

Authors - Jianming Yang
mouseIF

EMBO J

Myeloid cells protect intestinal epithelial barrier integrity through the angiogenin/plexin-B2 axis.

Authors - Rongpan Bai
mouseIHC,IF

Carbohydr Polym

Polygonatum cyrtonema Hua polysaccharide alleviates ulcerative colitis via gut microbiota-independent modulation of inflammatory immune response

Authors - Jin-Yang Shi
mouseIF

Pharmacol Res

λ-carrageenan exacerbates Citrobacter rodentium-induced infectious colitis in mice by targeting gut microbiota and intestinal barrier integrity

Authors - Wei Wu
mouseIF

NPJ Biofilms Microbiomes

Impact of structurally diverse polysaccharides on colonic mucin O-glycosylation and gut microbiota

Authors - Tong Zhao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Balawant (Verified Customer) (08-24-2022)

This is great Antibody. it has no background

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1500
  • Cell Tissue Type: colon tissue and colon cancer cells line
Loading...
||
New chat Able
正在加载,请稍候...