CoraLite® Plus 488-conjugated MUC2 Polyclonal antibody

MUC2 Polyclonal Antibody for IF/ICC
Cat No. CL488-27675

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse

Applications

IF/ICC

Intestinal mucin 2, MLP, MUC 2, MUC2, Mucin 2, SMUC

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27675 targets MUC2 in IF/ICC applications and shows reactivity with Human, Mouse samples.

Tested Reactivity Human, Mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25800

Product name: Recombinant human MUC2 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 726-850 aa of M94132

Sequence: MYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWV

Predict reactive species
Full Name mucin 2, oligomeric mucus/gel-forming
Calculated Molecular Weight 540 kDa
GenBank Accession NumberM94132
Gene Symbol MUC2
Gene ID (NCBI) 4583
RRIDAB_3084111
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MUC2 antibody CL488-27675Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...