MUC2 Polyclonal antibody, PBS Only

• 

  IHC staining of human colon using 27675-1-AP (same clone as 27675-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27675-1-AP (MUC2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 27675-1-AP (same clone as 27675-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27675-1-AP (MUC2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat small intestine using 27675-1-AP (same clone as 27675-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 27675-1-AP (MUC2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 27675-1-AP (same clone as 27675-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 27675-1-AP (MUC2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat small intestine using 27675-1-AP (same clone as 27675-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 27675-1-AP (MUC2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 27675-1-AP (same clone as 27675-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 27675-1-AP (MUC2 antibody) at dilution of 1:2000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 27675-1-AP (same clone as 27675-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 27675-1-AP (MUC2 antibody) at dilution of 1:2000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat small intestine using 27675-1-AP (same clone as 27675-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat small intestine tissue using MUC2 antibody (27675-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), smooth muscle actin specific antibody (67735-1-Ig, Clone: 1E9A11, red). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat small intestine using 27675-1-AP (same clone as 27675-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat small intestine tissue using MUC2 antibody (27675-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), smooth muscle actin specific antibody (67735-1-Ig, Clone: 1E9A11, red). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat small intestine using 27675-1-AP (same clone as 27675-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat small intestine tissue using MUC2 antibody (27675-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 594-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR004), smooth muscle actin specific antibody (67735-1-Ig, Clone: 1E9A11, green). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human colon using 27675-1-AP (same clone as 27675-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human colon tissue using MUC2 antibody (27675-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse colon using 27675-1-AP (same clone as 27675-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse colon tissue using MUC2 antibody (27675-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SW480 using 27675-1-AP (same clone as 27675-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed SW480 cells using MUC2 antibody (27675-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 27675-1-AP (same clone as 27675-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using MUC2 antibody (27675-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 27675-1-AP (same clone as 27675-1-PBS)

  1x10^6 MCF-7 cells were intracellularly stained with 0.13 ug MUC2 Polyclonal antibody (27675-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.13 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 27675-1-PBS in a different storage buffer formulation.

MUC2 Polyclonal Antibody for IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Cat No. 27675-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Synonyms

MUC 2, MUC-2, Mucin 2, SMUC

---

Product Information

27675-1-PBS targets MUC2 in IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25800

  Product name: Recombinant human MUC2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 726-850 aa of M94132

  Sequence: MYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWV

• Full Name: mucin 2, oligomeric mucus/gel-forming
• Calculated Molecular Weight: 540 kDa
• GenBank Accession Number: M94132
• Gene Symbol: MUC2
• Gene ID (NCBI): 4583
• RRID: AB_2880943
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis.