MUC2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MUC2 Polyclonal antibody (27675-1-AP)

MUC2 Polyclonal Antibody for IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 27675-1-AP

Publications(216)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

Synonyms

MUC 2, MUC-2, Mucin 2, SMUC

• 

  IHC staining of human colon using 27675-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27675-1-AP (MUC2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 27675-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27675-1-AP (MUC2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat small intestine using 27675-1-AP

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 27675-1-AP (MUC2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat small intestine using 27675-1-AP

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 27675-1-AP (MUC2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 27675-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 27675-1-AP (MUC2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse small intestine using 27675-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 27675-1-AP (MUC2 antibody) at dilution of 1:2000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse small intestine using 27675-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 27675-1-AP (MUC2 antibody) at dilution of 1:2000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat small intestine using 27675-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat small intestine tissue using MUC2 antibody (27675-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), smooth muscle actin specific antibody (67735-1-Ig, Clone: 1E9A11, red). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat small intestine using 27675-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat small intestine tissue using MUC2 antibody (27675-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), smooth muscle actin specific antibody (67735-1-Ig, Clone: 1E9A11, red). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat small intestine using 27675-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat small intestine tissue using MUC2 antibody (27675-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 594-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR004), smooth muscle actin specific antibody (67735-1-Ig, Clone: 1E9A11, green). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human colon using 27675-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human colon tissue using MUC2 antibody (27675-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse colon using 27675-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse colon tissue using MUC2 antibody (27675-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SW480 using 27675-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed SW480 cells using MUC2 antibody (27675-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 27675-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using MUC2 antibody (27675-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of MCF-7 using 27675-1-AP

  1x10^6 MCF-7 cells were intracellularly stained with 0.13 ug MUC2 Polyclonal antibody (27675-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.13 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IHC detected in: human colon tissue, human pancreas cancer tissue, mouse small intestine tissue, rat small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human colon tissue, mouse colon tissue, rat small intestine tissue
• Positive IF/ICC detected in: HepG2 cells, SW480 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.13 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27675-1-AP targets MUC2 in IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, chicken, duck, mosquito
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25800

  Product name: Recombinant human MUC2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 726-850 aa of M94132

  Sequence: MYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWV

• Full Name: mucin 2, oligomeric mucus/gel-forming
• Calculated Molecular Weight: 540 kDa
• GenBank Accession Number: M94132
• Gene Symbol: MUC2
• Gene ID (NCBI): 4583
• RRID: AB_2880943
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02817
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Circulation; Microplastic Exposure Aggravates Cardiomyopathy Under Hemodynamic Stress Through the Gut-Heart Axis; Authors - Jing Wang
	IF	Gastroenterology; Structural Variations in Ulcerative Colitis-associated Escherichia coli Reduce Fructose Utilization and Aggravate Inflammation Under High-Fructose Diet; Authors - Xia Wu
mouse	WB,IP,IF-P	Nat Microbiol; IL-22 promotes genesis of small intestinal secretory cells that protect against cholera in mice.; Authors - Masataka Suzuki ; KO Validated
mouse	IF	Nat Commun; Microbiota-derived IPA protects against colitis by regulating intestinal HMGCS2-mediated ketogenesis to facilitate mucosal healing.; Authors - Yanan Zhang
		Nat Commun; Targeting NAT10 alleviates colonic senescence and elderly-onset colitis by disrupting N4-acetylation of DYRK1A; Authors - Jingyu Chen
mouse	IF	Nat Commun; Dubosiella newyorkensis modulates immune tolerance in colitis via the L-lysine-activated AhR-IDO1-Kyn pathway; Authors - Yanan Zhang

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Balawant (Verified Customer) (08-24-2022)

This is great Antibody. it has no background

• Applications: Western Blot
• Primary Antibody Dilution: 1:1500
• Cell Tissue Type: colon tissue and colon cancer cells line