MUC2 Recombinant monoclonal antibody, PBS Only

MUC2 Uni-rAb® Recombinant Antibody for IHC, IF-P, Indirect ELISA
Cat No. 82792-2-PBS
Clone No.250669F4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

MUC 2, MUC-2, Mucin 2, SMUC

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82792-2-PBS targets MUC2 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25800

Product name: Recombinant human MUC2 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 726-850 aa of M94132

Sequence: MYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWV

Predict reactive species
Full Name mucin 2, oligomeric mucus/gel-forming
Calculated Molecular Weight 540 kDa
GenBank Accession NumberM94132
Gene Symbol MUC2
Gene ID (NCBI) 4583
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis.

Loading...
||
New chat

Able

正在加载,请稍候...