MUC2 Recombinant monoclonal antibody

• 

  IHC staining of human colon using 82792-2-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 82792-2-RR (MUC2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 82792-2-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 82792-2-RR (MUC2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 82792-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 82792-2-RR (MUC2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 82792-2-RR

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 82792-2-RR (MUC2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 82792-2-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 82792-2-RR (MUC2 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human colon using 82792-2-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human colon tissue using MUC2 antibody (82792-2-RR, Clone: 250669F4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse colon using 82792-2-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using MUC2 antibody (82792-2-RR, Clone: 250669F4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 82792-2-RR

  Biolayer interferometry (BLl) kinetic assays of 82792-2-RR against Human MUC2 were performed. The affinity constant is below 1 pM.

MUC2 Uni-rAb^® Recombinant Antibody for IHC, IF-P, ELISA

Cat No. 82792-2-RR

Clone No.250669F4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, ELISA

Synonyms

MUC 2, MUC-2, Mucin 2, SMUC

---

Tested Applications

• Positive IHC detected in: mouse colon tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse colon tissue, human colon tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

82792-2-RR targets MUC2 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25800

  Product name: Recombinant human MUC2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 726-850 aa of M94132

  Sequence: MYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWV

• Full Name: mucin 2, oligomeric mucus/gel-forming
• Calculated Molecular Weight: 540 kDa
• GenBank Accession Number: M94132
• Gene Symbol: MUC2
• Gene ID (NCBI): 4583
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis.