Home
Products
Primary Antibodies
MYBPC3 Monoclonal antibody, PBS Only (Capture) (67608-1-PBS)

Filter: AllWBIHCIF-PCytometric bead array sample testCytometric bead array

WB analysis of mouse heart using 67608-1-Ig (same clone as 67608-1-PBS)
mouse heart tissue were subjected to SDS PAGE followed by western blot with 67608-1-Ig (MYBPC3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67608-1-PBS in a different storage buffer formulation.
WB analysis of H9C2 using 67608-1-Ig (same clone as 67608-1-PBS)
H9C2 cells were subjected to SDS PAGE followed by western blot with 67608-1-Ig (MYBPC3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67608-1-PBS in a different storage buffer formulation.
WB analysis of rabbit heart using 67608-1-Ig (same clone as 67608-1-PBS)
rabbit heart tissue were subjected to SDS PAGE followed by western blot with 67608-1-Ig (MYBPC3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67608-1-PBS in a different storage buffer formulation.
WB analysis of pig heart using 67608-1-Ig (same clone as 67608-1-PBS)
pig heart tissue were subjected to SDS PAGE followed by western blot with 67608-1-Ig (MYBPC3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67608-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 67608-1-Ig (same clone as 67608-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 67608-1-Ig (MYBPC3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67608-1-PBS in a different storage buffer formulation.
IHC staining of rat heart using 67608-1-Ig (same clone as 67608-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 67608-1-Ig (MYBPC3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67608-1-PBS in a different storage buffer formulation.
IF Staining of rat heart using 67608-1-Ig (same clone as 67608-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed rat heart tissue using MYBPC3 antibody (67608-1-Ig, Clone: 3C8F8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67608-1-PBS in a different storage buffer formulation.
Cytometric bead array sample test of MP51741-1
Cytometric bead array sample test of MP51741-1, MYBPC3 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67608-1-PBS. Detection antibody: 67608-2-PBS.
Cytometric bead array standard curve of MP51741-1
Cytometric bead array standard curve of MP51741-1, MYBPC3 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67608-1-PBS. Detection antibody: 67608-2-PBS. Standard:Ag15848. Range: 1.563-200 ng/mL.

MYBPC3 Monoclonal antibody, PBS Only (Capture)

Name: MYBPC3 Monoclonal antibody, PBS Only (Capture)
Brand: Proteintech
SKU: 67608-1-PBS

MYBPC3 Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 67608-1-PBS

Clone No.3C8F8

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Synonyms

3C8F8, Cardiac MyBP C, Cardiac MyBP-C, C-protein, cardiac muscle isoform, MYBPC 3

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67608-1-PBS targets MYBPC3 as part of a matched antibody pair:

MP51741-1: 67608-1-PBS capture and 67608-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat, pig, rabbit
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag15848 Product name: Recombinant human MYBPC3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-328 aa of BC151211 Sequence: MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA Predict reactive species
Full Name	myosin binding protein C, cardiac
Calculated Molecular Weight	1274 aa, 141 kDa
Observed Molecular Weight	140-150 kDa
GenBank Accession Number	BC151211
Gene Symbol	MYBPC3
Gene ID (NCBI)	4607
RRID	AB_2882814
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q14896
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

MYBPC3 belongs to the immunoglobulin superfamily and MyBP family. MYBPC3 located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. Defects in MYBPC3 are the cause of cardiomyopathy familial hypertrophic type 4 (CMH4).