MYBPC3 Monoclonal antibody, PBS Only

• 

  WB analysis of mouse heart using 67608-1-Ig (same clone as 67608-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 67608-1-Ig (MYBPC3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67608-1-PBS in a different storage buffer formulation.

• 

  WB analysis of H9C2 using 67608-1-Ig (same clone as 67608-1-PBS)

  H9C2 cells were subjected to SDS PAGE followed by western blot with 67608-1-Ig (MYBPC3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67608-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit heart using 67608-1-Ig (same clone as 67608-1-PBS)

  rabbit heart tissue were subjected to SDS PAGE followed by western blot with 67608-1-Ig (MYBPC3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67608-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig heart using 67608-1-Ig (same clone as 67608-1-PBS)

  pig heart tissue were subjected to SDS PAGE followed by western blot with 67608-1-Ig (MYBPC3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67608-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 67608-1-Ig (same clone as 67608-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 67608-1-Ig (MYBPC3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67608-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 67608-1-Ig (same clone as 67608-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 67608-1-Ig (MYBPC3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67608-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat heart using 67608-1-Ig (same clone as 67608-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat heart tissue using MYBPC3 antibody (67608-1-Ig, Clone: 3C8F8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67608-1-PBS in a different storage buffer formulation.

MYBPC3 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67608-1-PBS

Clone No.3C8F8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

3C8F8, Cardiac MyBP C, Cardiac MyBP-C, C-protein, cardiac muscle isoform, MYBPC 3

---

Product Information

67608-1-PBS targets MYBPC3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15848

  Product name: Recombinant human MYBPC3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-328 aa of BC151211

  Sequence: MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA

• Full Name: myosin binding protein C, cardiac
• Calculated Molecular Weight: 1274 aa, 141 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC151211
• Gene Symbol: MYBPC3
• Gene ID (NCBI): 4607
• RRID: AB_2882814
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14896
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYBPC3 belongs to the immunoglobulin superfamily and MyBP family. MYBPC3 located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. Defects in MYBPC3 are the cause of cardiomyopathy familial hypertrophic type 4 (CMH4).