MYCBP Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85891-1-RR (same clone as 85891-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85891-1-RR (MYCBP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85891-1-PBS in a different storage buffer formulation.

MYCBP Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85891-1-PBS

Clone No.250129G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

AMY 1, AMY1, AMY-1, Associate of Myc 1, c-Myc-binding protein

---

Product Information

85891-1-PBS targets MYCBP in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2651

  Product name: Recombinant human MYCBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-103 aa of BC008686

  Sequence: MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE

• Full Name: c-myc binding protein
• Calculated Molecular Weight: 103 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC008686
• Gene Symbol: MYCBP
• Gene ID (NCBI): 26292
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99417
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYC binding protein(MYCBP), encoded by MYCBP gene, binds to N-terminal region of MYC, and then MYC can activate E box-dependent transcription. Upon increasing expression of MYC , MYCBP translocates into the nucleus in the S phase of the cell cycle. MYCBP may involve in spermatogenesis, since it's found to be interacted with AKAP84/149 in the mitochondria in somatic cells and sperm. It highly expressed in heart, placenta, pancreas,skeletal muscle and kidney, but low in lung. This is a rabbit polyclonal antibody raised against full-length MYCBP of human origin.