Product Information
85891-1-PBS targets MYCBP in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag2651 Product name: Recombinant human MYCBP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC008686 Sequence: MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE Predict reactive species |
| Full Name | c-myc binding protein |
| Calculated Molecular Weight | 103 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC008686 |
| Gene Symbol | MYCBP |
| Gene ID (NCBI) | 26292 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q99417 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
MYC binding protein(MYCBP), encoded by MYCBP gene, binds to N-terminal region of MYC, and then MYC can activate E box-dependent transcription. Upon increasing expression of MYC , MYCBP translocates into the nucleus in the S phase of the cell cycle. MYCBP may involve in spermatogenesis, since it's found to be interacted with AKAP84/149 in the mitochondria in somatic cells and sperm. It highly expressed in heart, placenta, pancreas,skeletal muscle and kidney, but low in lung. This is a rabbit polyclonal antibody raised against full-length MYCBP of human origin.



